BLASTX nr result
ID: Papaver30_contig00020612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00020612 (2166 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium r... 68 4e-08 >gb|KJB18362.1| hypothetical protein B456_003G048700 [Gossypium raimondii] Length = 86 Score = 67.8 bits (164), Expect = 4e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 1226 MMIKLRLVSQEHSQLPPKSFRLSPGLRANAALFLPWMSET 1345 MMI RLVSQ+HSQ PP+SFRLSPGLRA+A L LPWMSET Sbjct: 1 MMINQRLVSQKHSQWPPESFRLSPGLRASAVLLLPWMSET 40