BLASTX nr result
ID: Papaver30_contig00019012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00019012 (494 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006404635.1| hypothetical protein EUTSA_v10000480mg, part... 65 2e-08 gb|KHN34035.1| Ribonucleoside-diphosphate reductase large subuni... 64 4e-08 ref|XP_003525096.1| PREDICTED: ribonucleoside-diphosphate reduct... 64 4e-08 ref|XP_011090448.1| PREDICTED: ribonucleoside-diphosphate reduct... 63 1e-07 ref|XP_011090447.1| PREDICTED: ribonucleoside-diphosphate reduct... 63 1e-07 ref|XP_002984638.1| hypothetical protein SELMODRAFT_156827 [Sela... 63 1e-07 ref|XP_002978710.1| hypothetical protein SELMODRAFT_109545 [Sela... 62 2e-07 gb|EYU31120.1| hypothetical protein MIMGU_mgv1a001476mg [Erythra... 61 3e-07 ref|XP_012853997.1| PREDICTED: ribonucleoside-diphosphate reduct... 61 3e-07 emb|CDP12851.1| unnamed protein product [Coffea canephora] 60 5e-07 gb|AFF18831.1| ribonucleotide reductase large subunit A, partial... 60 5e-07 gb|KRH64118.1| hypothetical protein GLYMA_04G217300 [Glycine max] 60 6e-07 gb|KNA13477.1| hypothetical protein SOVF_116750 [Spinacia oleracea] 60 6e-07 gb|KHN09569.1| Ribonucleoside-diphosphate reductase large subuni... 60 6e-07 ref|XP_010680296.1| PREDICTED: ribonucleoside-diphosphate reduct... 60 6e-07 ref|XP_009800951.1| PREDICTED: ribonucleoside-diphosphate reduct... 60 6e-07 ref|XP_009595268.1| PREDICTED: ribonucleoside-diphosphate reduct... 60 6e-07 ref|XP_012075285.1| PREDICTED: ribonucleoside-diphosphate reduct... 60 6e-07 ref|NP_001236466.1| ribonucleotide reductase large subunit B [Gl... 60 6e-07 ref|XP_003523246.1| PREDICTED: ribonucleoside-diphosphate reduct... 60 6e-07 >ref|XP_006404635.1| hypothetical protein EUTSA_v10000480mg, partial [Eutrema salsugineum] gi|557105763|gb|ESQ46088.1| hypothetical protein EUTSA_v10000480mg, partial [Eutrema salsugineum] Length = 415 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/50 (56%), Positives = 39/50 (78%) Frame = +3 Query: 12 KKMYTKYEIEVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 +K+YTKYE EVT V N NK++D++ YPV++ K N++HR IGIG+QGL Sbjct: 319 EKLYTKYEREVTASVTINHNKIIDVNYYPVETVKTSNIRHRPIGIGVQGL 368 >gb|KHN34035.1| Ribonucleoside-diphosphate reductase large subunit [Glycine soja] Length = 809 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +VATN NK++D++ YPVD+A+R NM+HR IGIG+QGL Sbjct: 487 EVTAIVATNLNKIIDVNYYPVDTARRSNMRHRPIGIGVQGL 527 >ref|XP_003525096.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Glycine max] gi|27261142|gb|AAN87547.1|AF118784_1 ribonucleotide reductase large subunit A [Glycine max] gi|947111180|gb|KRH59506.1| hypothetical protein GLYMA_05G186900 [Glycine max] Length = 809 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +VATN NK++D++ YPVD+A+R NM+HR IGIG+QGL Sbjct: 487 EVTAIVATNLNKIIDVNYYPVDTARRSNMRHRPIGIGVQGL 527 >ref|XP_011090448.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit isoform X2 [Sesamum indicum] Length = 809 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVTT+V TN NK++D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EVTTIVTTNLNKIIDVNYYPVETAKRSNLRHRPIGIGVQGL 527 >ref|XP_011090447.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit isoform X1 [Sesamum indicum] Length = 844 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVTT+V TN NK++D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EVTTIVTTNLNKIIDVNYYPVETAKRSNLRHRPIGIGVQGL 527 >ref|XP_002984638.1| hypothetical protein SELMODRAFT_156827 [Selaginella moellendorffii] gi|300147620|gb|EFJ14283.1| hypothetical protein SELMODRAFT_156827 [Selaginella moellendorffii] Length = 803 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVTTVV N NK++DI+ YPVD+AKR N++HR IGIG+QGL Sbjct: 484 EVTTVVTENLNKIIDINYYPVDTAKRSNLRHRPIGIGVQGL 524 >ref|XP_002978710.1| hypothetical protein SELMODRAFT_109545 [Selaginella moellendorffii] gi|300153519|gb|EFJ20157.1| hypothetical protein SELMODRAFT_109545 [Selaginella moellendorffii] Length = 786 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 +VTTVV N NK++DI+ YPVD+AKR N++HR IGIG+QGL Sbjct: 459 QVTTVVTENLNKIIDINYYPVDTAKRSNLRHRPIGIGVQGL 499 >gb|EYU31120.1| hypothetical protein MIMGU_mgv1a001476mg [Erythranthe guttata] Length = 812 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +V TN NK++D++ YPV++AKR NM+HR IGIG+QGL Sbjct: 487 EVTALVTTNLNKIIDVNYYPVETAKRSNMRHRPIGIGVQGL 527 >ref|XP_012853997.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Erythranthe guttatus] gi|604304229|gb|EYU23562.1| hypothetical protein MIMGU_mgv1a001491mg [Erythranthe guttata] Length = 809 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +V TN NK++D++ YPV++AKR NM+HR IGIG+QGL Sbjct: 487 EVTALVTTNLNKIIDVNYYPVETAKRSNMRHRPIGIGVQGL 527 >emb|CDP12851.1| unnamed protein product [Coffea canephora] Length = 808 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +V +N NK++DI+ YPVD+AKR N +HR IGIG+QGL Sbjct: 487 EVTAIVTSNLNKIIDINYYPVDTAKRSNFRHRPIGIGVQGL 527 >gb|AFF18831.1| ribonucleotide reductase large subunit A, partial [Dimocarpus longan] Length = 421 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/52 (53%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = +3 Query: 12 KKMYTKYE--IEVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 K Y +E EVT +V N NK++D++ YPV++AKR NM+HR IGIG+QGL Sbjct: 161 KNRYFDFEKLAEVTAIVTENLNKIIDVNYYPVENAKRSNMRHRPIGIGVQGL 212 >gb|KRH64118.1| hypothetical protein GLYMA_04G217300 [Glycine max] Length = 805 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 E+T +V TN NKV+D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EITALVTTNLNKVIDVNYYPVENAKRSNLRHRPIGIGVQGL 527 >gb|KNA13477.1| hypothetical protein SOVF_116750 [Spinacia oleracea] Length = 812 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EV VV TN NK++D++ YPV++AKR NM+HR IGIG+QGL Sbjct: 487 EVVEVVTTNLNKIIDVNFYPVETAKRSNMRHRPIGIGVQGL 527 >gb|KHN09569.1| Ribonucleoside-diphosphate reductase large subunit [Glycine soja] gi|947105443|gb|KRH53826.1| hypothetical protein GLYMA_06G148500 [Glycine max] Length = 808 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 E+T +V TN NKV+D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EITALVTTNLNKVIDVNYYPVENAKRSNLRHRPIGIGVQGL 527 >ref|XP_010680296.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Beta vulgaris subsp. vulgaris] gi|870857686|gb|KMT09234.1| hypothetical protein BVRB_6g133350 [Beta vulgaris subsp. vulgaris] Length = 810 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EV VV TN NK++D++ YPV++AKR NM+HR IGIG+QGL Sbjct: 487 EVVDVVTTNLNKIIDVNFYPVETAKRSNMRHRPIGIGVQGL 527 >ref|XP_009800951.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Nicotiana sylvestris] Length = 808 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +V TN NK++D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EVTALVTTNLNKIIDVNYYPVETAKRSNLRHRPIGIGVQGL 527 >ref|XP_009595268.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Nicotiana tomentosiformis] Length = 808 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT +V TN NK++D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EVTALVTTNLNKIIDVNYYPVETAKRSNLRHRPIGIGVQGL 527 >ref|XP_012075285.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Jatropha curcas] gi|643726616|gb|KDP35296.1| hypothetical protein JCGZ_09455 [Jatropha curcas] Length = 809 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 EVT VV TN NK++D++ YPV++AKR N +HR IGIG+QGL Sbjct: 487 EVTEVVTTNLNKIIDVNYYPVENAKRSNFRHRPIGIGVQGL 527 >ref|NP_001236466.1| ribonucleotide reductase large subunit B [Glycine max] gi|27261144|gb|AAN87548.1|AF118785_1 ribonucleotide reductase large subunit B [Glycine max] Length = 808 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 E+T +V TN NKV+D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EITALVTTNLNKVIDVNYYPVENAKRSNLRHRPIGIGVQGL 527 >ref|XP_003523246.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Glycine max] gi|947115814|gb|KRH64116.1| hypothetical protein GLYMA_04G217300 [Glycine max] gi|947115815|gb|KRH64117.1| hypothetical protein GLYMA_04G217300 [Glycine max] Length = 808 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = +3 Query: 39 EVTTVVATNFNKVVDISCYPVDSAKR*NMKHRLIGIGIQGL 161 E+T +V TN NKV+D++ YPV++AKR N++HR IGIG+QGL Sbjct: 487 EITALVTTNLNKVIDVNYYPVENAKRSNLRHRPIGIGVQGL 527