BLASTX nr result
ID: Papaver30_contig00017949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00017949 (449 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008800962.1| PREDICTED: basic leucine zipper and W2 domai... 57 7e-06 ref|XP_008441730.1| PREDICTED: basic leucine zipper and W2 domai... 57 7e-06 ref|XP_004138904.1| PREDICTED: basic leucine zipper and W2 domai... 57 7e-06 >ref|XP_008800962.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2 [Phoenix dactylifera] Length = 411 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 KEGMLDLVDYNAKKMFDVKLKEMKSALTTQIA 98 KEG+L LV+YN KKMF+VKLKEMKSALTTQIA Sbjct: 234 KEGLLSLVEYNEKKMFEVKLKEMKSALTTQIA 265 >ref|XP_008441730.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Cucumis melo] Length = 411 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 KEGMLDLVDYNAKKMFDVKLKEMKSALTTQIA 98 KEG++ LV+YNAKKMFDVKL EMKSALTTQIA Sbjct: 234 KEGLVPLVEYNAKKMFDVKLSEMKSALTTQIA 265 >ref|XP_004138904.1| PREDICTED: basic leucine zipper and W2 domain-containing protein 2-like [Cucumis sativus] gi|700206239|gb|KGN61358.1| hypothetical protein Csa_2G097440 [Cucumis sativus] Length = 411 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 KEGMLDLVDYNAKKMFDVKLKEMKSALTTQIA 98 KEG++ LV+YNAKKMFDVKL EMKSALTTQIA Sbjct: 234 KEGLVPLVEYNAKKMFDVKLSEMKSALTTQIA 265