BLASTX nr result
ID: Papaver30_contig00017288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00017288 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514407.1| Aminoacylase-1, putative [Ricinus communis] ... 45 9e-07 ref|XP_006307525.1| hypothetical protein CARUB_v10009148mg [Caps... 43 9e-07 >ref|XP_002514407.1| Aminoacylase-1, putative [Ricinus communis] gi|223546504|gb|EEF48003.1| Aminoacylase-1, putative [Ricinus communis] Length = 459 Score = 45.1 bits (105), Expect(3) = 9e-07 Identities = 22/34 (64%), Positives = 24/34 (70%) Frame = -2 Query: 341 REGQFDWIKSRLSMNSEVVSVNLVHLKAGTPLPT 240 R QFD +KS L EVVSVN+V LKAGTP PT Sbjct: 263 RASQFDLVKSGLKAEGEVVSVNMVSLKAGTPSPT 296 Score = 31.2 bits (69), Expect(3) = 9e-07 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 399 GIPGHG*RMFDNSDMENFTK 340 G PGHG +++DNS MEN K Sbjct: 235 GAPGHGAKLYDNSAMENLLK 254 Score = 22.3 bits (46), Expect(3) = 9e-07 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 139 GYQMNMGPLEAGAGF 95 G+ MN+ P EA AGF Sbjct: 297 GFVMNLQPSEAEAGF 311 >ref|XP_006307525.1| hypothetical protein CARUB_v10009148mg [Capsella rubella] gi|482576236|gb|EOA40423.1| hypothetical protein CARUB_v10009148mg [Capsella rubella] Length = 442 Score = 42.7 bits (99), Expect(3) = 9e-07 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -2 Query: 341 REGQFDWIKSRLSMNSEVVSVNLVHLKAGTPLPTVSFVIS 222 RE QFD +K+ + NSEV+SVN V+LKAGTP T FV++ Sbjct: 251 RETQFDLVKAGKAANSEVISVNPVYLKAGTP-STNGFVMN 289 Score = 33.1 bits (74), Expect(3) = 9e-07 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 399 GIPGHG*RMFDNSDMENFTK 340 GIPGHG +++DNS MEN K Sbjct: 223 GIPGHGAKLYDNSAMENLMK 242 Score = 22.7 bits (47), Expect(3) = 9e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 142 HGYQMNMGPLEAGAGF 95 +G+ MNM P EA AG+ Sbjct: 284 NGFVMNMQPSEAEAGY 299