BLASTX nr result
ID: Papaver30_contig00017259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00017259 (440 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279347.1| PREDICTED: eukaryotic translation initiation... 174 2e-41 ref|XP_010269397.1| PREDICTED: eukaryotic translation initiation... 173 5e-41 ref|XP_010275422.1| PREDICTED: eukaryotic translation initiation... 172 7e-41 ref|XP_008785406.1| PREDICTED: eukaryotic translation initiation... 170 4e-40 ref|XP_002526864.1| eukaryotic translation initiation factor 3f,... 169 8e-40 ref|XP_011076724.1| PREDICTED: eukaryotic translation initiation... 168 2e-39 ref|XP_010923104.1| PREDICTED: eukaryotic translation initiation... 167 2e-39 ref|XP_010923102.1| PREDICTED: eukaryotic translation initiation... 167 2e-39 ref|XP_009791111.1| PREDICTED: eukaryotic translation initiation... 166 8e-39 ref|XP_012087805.1| PREDICTED: eukaryotic translation initiation... 165 1e-38 ref|XP_002315172.1| Eukaryotic translation initiation factor 3 s... 164 3e-38 ref|XP_009627880.1| PREDICTED: eukaryotic translation initiation... 163 4e-38 ref|XP_009791323.1| PREDICTED: eukaryotic translation initiation... 163 5e-38 ref|XP_006355662.1| PREDICTED: eukaryotic translation initiation... 163 5e-38 ref|XP_012455492.1| PREDICTED: eukaryotic translation initiation... 162 9e-38 gb|KHG29398.1| Eukaryotic translation initiation factor 3 subuni... 162 9e-38 ref|XP_009626924.1| PREDICTED: eukaryotic translation initiation... 162 1e-37 ref|XP_004250348.1| PREDICTED: eukaryotic translation initiation... 161 2e-37 gb|KNA22940.1| hypothetical protein SOVF_029310 [Spinacia oleracea] 160 3e-37 ref|XP_011035994.1| PREDICTED: eukaryotic translation initiation... 160 3e-37 >ref|XP_002279347.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F [Vitis vinifera] gi|296086088|emb|CBI31529.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 174 bits (441), Expect = 2e-41 Identities = 84/93 (90%), Positives = 86/93 (92%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M E VLQF PSSTSLSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGS+S DGTVDI Sbjct: 1 MASSESAVLQFFPSSTSLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSISPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN Sbjct: 61 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 93 >ref|XP_010269397.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nelumbo nucifera] Length = 285 Score = 173 bits (438), Expect = 5e-41 Identities = 84/93 (90%), Positives = 86/93 (92%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M E+ VLQF PSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGS+S DGTVDI Sbjct: 1 MAAREKAVLQFFPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSISPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPHNESSDQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHNESSDQVALDIDYHHNMLYSHQKVN 93 >ref|XP_010275422.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nelumbo nucifera] Length = 285 Score = 172 bits (437), Expect = 7e-41 Identities = 84/93 (90%), Positives = 86/93 (92%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M E TVLQF PSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGS+S DGTV+I Sbjct: 1 MASREPTVLQFFPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSISPDGTVEI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPHNESSDQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHNESSDQVALDIDYHHNMLTSHQKVN 93 >ref|XP_008785406.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F [Phoenix dactylifera] Length = 285 Score = 170 bits (430), Expect = 4e-40 Identities = 79/93 (84%), Positives = 88/93 (94%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M G+QTVLQF PS+TSLSA+VHPVV+FNICDCYVRRPDQA+RVIGTLLGSVS DGTV+I Sbjct: 1 MAAGKQTVLQFFPSTTSLSARVHPVVLFNICDCYVRRPDQADRVIGTLLGSVSPDGTVEI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 +NSYAVPHNES+DQVALDIDYHHNM +SHQKVN Sbjct: 61 KNSYAVPHNESADQVALDIDYHHNMFMSHQKVN 93 >ref|XP_002526864.1| eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] gi|223533763|gb|EEF35495.1| eukaryotic translation initiation factor 3f, eif3f, putative [Ricinus communis] Length = 287 Score = 169 bits (428), Expect = 8e-40 Identities = 85/95 (89%), Positives = 86/95 (90%), Gaps = 2/95 (2%) Frame = -1 Query: 281 MTGGEQTVLQFH--PSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTV 108 M EQTVLQF PSST LSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTV Sbjct: 1 MAASEQTVLQFTSAPSSTGLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTV 60 Query: 107 DIRNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 DIRNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN Sbjct: 61 DIRNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 95 >ref|XP_011076724.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Sesamum indicum] Length = 284 Score = 168 bits (425), Expect = 2e-39 Identities = 82/93 (88%), Positives = 85/93 (91%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M EQTVLQF PS TS+SA+VHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVDI Sbjct: 1 MGSNEQTVLQFVPSPTSVSARVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPHNESSDQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHNESSDQVALDIDYHHNMLSSHQKVN 93 >ref|XP_010923104.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F isoform X2 [Elaeis guineensis] gi|743790178|ref|XP_010923105.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F isoform X2 [Elaeis guineensis] Length = 285 Score = 167 bits (424), Expect = 2e-39 Identities = 78/93 (83%), Positives = 87/93 (93%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M +QTVLQF PS+TSLSA+VHPVV+FNICDCYVRRPDQA+RVIGTLLGSVS DGTV+I Sbjct: 1 MAASKQTVLQFFPSTTSLSARVHPVVLFNICDCYVRRPDQADRVIGTLLGSVSPDGTVEI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 +NSYAVPHNES+DQVALDIDYHHNM +SHQKVN Sbjct: 61 KNSYAVPHNESADQVALDIDYHHNMFMSHQKVN 93 >ref|XP_010923102.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F isoform X1 [Elaeis guineensis] Length = 313 Score = 167 bits (424), Expect = 2e-39 Identities = 78/93 (83%), Positives = 87/93 (93%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M +QTVLQF PS+TSLSA+VHPVV+FNICDCYVRRPDQA+RVIGTLLGSVS DGTV+I Sbjct: 1 MAASKQTVLQFFPSTTSLSARVHPVVLFNICDCYVRRPDQADRVIGTLLGSVSPDGTVEI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 +NSYAVPHNES+DQVALDIDYHHNM +SHQKVN Sbjct: 61 KNSYAVPHNESADQVALDIDYHHNMFMSHQKVN 93 >ref|XP_009791111.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nicotiana sylvestris] Length = 285 Score = 166 bits (419), Expect = 8e-39 Identities = 79/93 (84%), Positives = 84/93 (90%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M + T+LQF PSSTSLSAKVHP+VIFNICDCYVRRPDQA+RVIGTLLGSV DGTVDI Sbjct: 1 MASSDHTILQFSPSSTSLSAKVHPLVIFNICDCYVRRPDQADRVIGTLLGSVLPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPH+ES DQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHSESQDQVALDIDYHHNMLSSHQKVN 93 >ref|XP_012087805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F [Jatropha curcas] gi|643739003|gb|KDP44817.1| hypothetical protein JCGZ_01317 [Jatropha curcas] Length = 283 Score = 165 bits (417), Expect = 1e-38 Identities = 83/93 (89%), Positives = 84/93 (90%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M E TVLQ PSS SLSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVDI Sbjct: 1 MAASEHTVLQ--PSSMSLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDI 58 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN Sbjct: 59 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 91 >ref|XP_002315172.1| Eukaryotic translation initiation factor 3 subunit 5 family protein [Populus trichocarpa] gi|118484603|gb|ABK94175.1| unknown [Populus trichocarpa] gi|222864212|gb|EEF01343.1| Eukaryotic translation initiation factor 3 subunit 5 family protein [Populus trichocarpa] Length = 287 Score = 164 bits (414), Expect = 3e-38 Identities = 81/90 (90%), Positives = 86/90 (95%), Gaps = 1/90 (1%) Frame = -1 Query: 269 EQTVLQFHPSSTS-LSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDIRNS 93 +QTVLQF PSS+S LSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVDIRNS Sbjct: 6 QQTVLQFAPSSSSTLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNS 65 Query: 92 YAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 YAVPHNESS+QVALDIDYHHN+LLSHQKVN Sbjct: 66 YAVPHNESSEQVALDIDYHHNLLLSHQKVN 95 >ref|XP_009627880.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F {ECO:0000255|HAMAP-Rule:MF_03005}-like [Nicotiana tomentosiformis] Length = 285 Score = 163 bits (413), Expect = 4e-38 Identities = 78/93 (83%), Positives = 83/93 (89%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M + T+LQF PSST LSAKVHP+VIFNICDCYVRRPDQA+RVIGTLLGSV DGTVDI Sbjct: 1 MASSDHTILQFSPSSTILSAKVHPLVIFNICDCYVRRPDQADRVIGTLLGSVLPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPH+ES DQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHSESQDQVALDIDYHHNMLSSHQKVN 93 >ref|XP_009791323.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Nicotiana sylvestris] Length = 285 Score = 163 bits (412), Expect = 5e-38 Identities = 79/93 (84%), Positives = 83/93 (89%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M +QTVLQF PSS SLSA+V P+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVDI Sbjct: 1 MASSDQTVLQFSPSSASLSARVQPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPH+ES DQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHSESQDQVALDIDYHHNMLSSHQKVN 93 >ref|XP_006355662.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Solanum tuberosum] Length = 285 Score = 163 bits (412), Expect = 5e-38 Identities = 77/93 (82%), Positives = 83/93 (89%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M +QTVLQF PSS SLSAKVHP+VIFNICDC+VRRPDQAER+IGTLLGSV DGTVD+ Sbjct: 1 MASSDQTVLQFSPSSASLSAKVHPLVIFNICDCFVRRPDQAERIIGTLLGSVLPDGTVDV 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RN YAVPH+ES DQVALDIDYHHNML SHQKVN Sbjct: 61 RNCYAVPHSESEDQVALDIDYHHNMLSSHQKVN 93 >ref|XP_012455492.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Gossypium raimondii] gi|763807315|gb|KJB74253.1| hypothetical protein B456_011G283100 [Gossypium raimondii] Length = 286 Score = 162 bits (410), Expect = 9e-38 Identities = 79/94 (84%), Positives = 87/94 (92%), Gaps = 1/94 (1%) Frame = -1 Query: 281 MTGGEQTVLQFH-PSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVD 105 M G++TVLQF+ PSS SLSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVD Sbjct: 1 MAAGDRTVLQFNSPSSASLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVD 60 Query: 104 IRNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 IRNSYAVPH ES++QVALDI+YHHNML+SHQKVN Sbjct: 61 IRNSYAVPHTESAEQVALDIEYHHNMLVSHQKVN 94 >gb|KHG29398.1| Eukaryotic translation initiation factor 3 subunit F -like protein [Gossypium arboreum] Length = 286 Score = 162 bits (410), Expect = 9e-38 Identities = 79/94 (84%), Positives = 87/94 (92%), Gaps = 1/94 (1%) Frame = -1 Query: 281 MTGGEQTVLQFH-PSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVD 105 M G++TVLQF+ PSS SLSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVD Sbjct: 1 MAAGDRTVLQFNSPSSASLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVD 60 Query: 104 IRNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 IRNSYAVPH ES++QVALDI+YHHNML+SHQKVN Sbjct: 61 IRNSYAVPHTESAEQVALDIEYHHNMLVSHQKVN 94 >ref|XP_009626924.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F {ECO:0000255|HAMAP-Rule:MF_03005}-like [Nicotiana tomentosiformis] Length = 285 Score = 162 bits (409), Expect = 1e-37 Identities = 80/93 (86%), Positives = 82/93 (88%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M +QTVLQF PSS SLSAKV P VIFNICDCYVRRPDQAERVIGTLLGSV DGTVDI Sbjct: 1 MAYSDQTVLQFSPSSVSLSAKVQPSVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPH+ES DQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHSESQDQVALDIDYHHNMLSSHQKVN 93 >ref|XP_004250348.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Solanum lycopersicum] Length = 285 Score = 161 bits (408), Expect = 2e-37 Identities = 75/93 (80%), Positives = 83/93 (89%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M + T+LQF PSST +SAKVHP+VIFNICDC+VRRPDQA+R+IGTLLGSV DGTVDI Sbjct: 1 MASSDHTILQFSPSSTGISAKVHPLVIFNICDCFVRRPDQADRIIGTLLGSVLPDGTVDI 60 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPH+ES DQVALDIDYHHNML SHQKVN Sbjct: 61 RNSYAVPHSESQDQVALDIDYHHNMLSSHQKVN 93 >gb|KNA22940.1| hypothetical protein SOVF_029310 [Spinacia oleracea] Length = 284 Score = 160 bits (406), Expect = 3e-37 Identities = 79/93 (84%), Positives = 84/93 (90%) Frame = -1 Query: 281 MTGGEQTVLQFHPSSTSLSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDI 102 M GE+TVLQF STSL+ KVHP+VIFNICDCYVRRPDQAERVIGTLLGSV SDGTVD+ Sbjct: 1 MASGEKTVLQFG-GSTSLNVKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLSDGTVDV 59 Query: 101 RNSYAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 RNSYAVPHNE SDQVALDI+YHHNML SHQKVN Sbjct: 60 RNSYAVPHNEFSDQVALDIEYHHNMLTSHQKVN 92 >ref|XP_011035994.1| PREDICTED: eukaryotic translation initiation factor 3 subunit F-like [Populus euphratica] Length = 287 Score = 160 bits (406), Expect = 3e-37 Identities = 80/90 (88%), Positives = 85/90 (94%), Gaps = 1/90 (1%) Frame = -1 Query: 269 EQTVLQFHPSSTS-LSAKVHPVVIFNICDCYVRRPDQAERVIGTLLGSVSSDGTVDIRNS 93 +QTVLQF SS+S LSAKVHP+VIFNICDCYVRRPDQAERVIGTLLGSV DGTVDIRNS Sbjct: 6 QQTVLQFATSSSSTLSAKVHPLVIFNICDCYVRRPDQAERVIGTLLGSVLPDGTVDIRNS 65 Query: 92 YAVPHNESSDQVALDIDYHHNMLLSHQKVN 3 YAVPHNESS+QVALDIDYHHN+LLSHQKVN Sbjct: 66 YAVPHNESSEQVALDIDYHHNLLLSHQKVN 95