BLASTX nr result
ID: Papaver30_contig00015970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00015970 (1363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ58073.1| Mitochondrial uncoupling protein [Zostera marina] 64 4e-07 dbj|BAC06495.1| mitochondrial uncoupling protein [Helicodiceros ... 63 5e-07 ref|XP_011624710.1| PREDICTED: mitochondrial uncoupling protein ... 62 2e-06 ref|XP_012850228.1| PREDICTED: mitochondrial uncoupling protein ... 62 2e-06 gb|ERN09651.1| hypothetical protein AMTR_s00029p00201060 [Ambore... 62 2e-06 dbj|BAD51466.1| uncoupling protein a [Philodendron bipinnatifidum] 61 2e-06 ref|XP_010262729.1| PREDICTED: mitochondrial uncoupling protein ... 61 2e-06 ref|XP_010256706.1| PREDICTED: mitochondrial uncoupling protein ... 61 2e-06 ref|XP_009416184.1| PREDICTED: mitochondrial uncoupling protein ... 61 2e-06 ref|XP_009407533.1| PREDICTED: mitochondrial uncoupling protein ... 61 2e-06 ref|XP_008239736.1| PREDICTED: mitochondrial uncoupling protein ... 61 2e-06 ref|XP_002527871.1| mitochondrial uncoupling protein, putative [... 61 2e-06 ref|XP_007205615.1| hypothetical protein PRUPE_ppa009102mg [Prun... 61 2e-06 dbj|BAL41370.1| uncoupling protein [Arum maculatum] 61 2e-06 gb|ACQ42213.1| putative mitochondrial uncoupling protein [Actini... 61 2e-06 gb|KRH00136.1| hypothetical protein GLYMA_18G195400 [Glycine max] 61 3e-06 gb|KHN08310.1| Mitochondrial uncoupling protein 3 [Glycine soja] 61 3e-06 dbj|BAI49703.1| uncoupling protein [Lysichiton camtschatcensis] 61 3e-06 ref|XP_003552220.1| PREDICTED: mitochondrial uncoupling protein ... 61 3e-06 gb|AAL68563.1|AF452028_1 uncoupling protein 1b [Glycine max] 61 3e-06 >gb|KMZ58073.1| Mitochondrial uncoupling protein [Zostera marina] Length = 309 Score = 63.5 bits (153), Expect = 4e-07 Identities = 34/46 (73%), Positives = 38/46 (82%), Gaps = 2/46 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTIF*Q 2 TGALAI VANP LVKV+LQ EGK +P PRR+SG+LNAYSTIF Q Sbjct: 131 TGALAICVANPTDLVKVRLQAEGKLAPGMPRRYSGSLNAYSTIFRQ 176 >dbj|BAC06495.1| mitochondrial uncoupling protein [Helicodiceros muscivorus] Length = 304 Score = 63.2 bits (152), Expect = 5e-07 Identities = 34/43 (79%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK SP PRR+SGALNAYSTI Sbjct: 127 TGALAITVANPTDLVKVRLQAEGKLSPGIPRRYSGALNAYSTI 169 >ref|XP_011624710.1| PREDICTED: mitochondrial uncoupling protein 1 [Amborella trichopoda] Length = 304 Score = 61.6 bits (148), Expect = 2e-06 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTIF*Q 2 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Q Sbjct: 126 TGALAITVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTIIRQ 171 >ref|XP_012850228.1| PREDICTED: mitochondrial uncoupling protein 1 [Erythranthe guttatus] gi|604313307|gb|EYU26638.1| hypothetical protein MIMGU_mgv1a0106722mg [Erythranthe guttata] Length = 305 Score = 61.6 bits (148), Expect = 2e-06 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGAL IA+ANP LVKV+LQ EGK +P PRR+SGALNAYSTI Sbjct: 127 TGALGIAIANPTDLVKVRLQAEGKLAPGVPRRYSGALNAYSTI 169 >gb|ERN09651.1| hypothetical protein AMTR_s00029p00201060 [Amborella trichopoda] Length = 354 Score = 61.6 bits (148), Expect = 2e-06 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTIF*Q 2 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Q Sbjct: 126 TGALAITVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTIIRQ 171 >dbj|BAD51466.1| uncoupling protein a [Philodendron bipinnatifidum] Length = 250 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = -1 Query: 130 GALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 GALAI VANP LVKV+LQ EGK SP PRR+SGALNAYSTI Sbjct: 128 GALAITVANPTDLVKVRLQAEGKLSPGIPRRYSGALNAYSTI 169 >ref|XP_010262729.1| PREDICTED: mitochondrial uncoupling protein 1-like [Nelumbo nucifera] Length = 303 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 127 TGALAITVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTI 169 >ref|XP_010256706.1| PREDICTED: mitochondrial uncoupling protein 1-like [Nelumbo nucifera] Length = 379 Score = 61.2 bits (147), Expect = 2e-06 Identities = 34/46 (73%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTIF*Q 2 TGALAI VANP LVKV+LQ EGK SP PRR+ GALNAYSTI Q Sbjct: 203 TGALAITVANPTDLVKVRLQAEGKLSPGVPRRYFGALNAYSTIIRQ 248 >ref|XP_009416184.1| PREDICTED: mitochondrial uncoupling protein 1-like [Musa acuminata subsp. malaccensis] Length = 303 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 125 TGALAITVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTI 167 >ref|XP_009407533.1| PREDICTED: mitochondrial uncoupling protein 1-like [Musa acuminata subsp. malaccensis] Length = 303 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 125 TGALAITVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTI 167 >ref|XP_008239736.1| PREDICTED: mitochondrial uncoupling protein 1 [Prunus mume] Length = 305 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 127 TGALAITVANPTDLVKVRLQAEGKLPPGAPRRYSGALNAYSTI 169 >ref|XP_002527871.1| mitochondrial uncoupling protein, putative [Ricinus communis] gi|223532722|gb|EEF34502.1| mitochondrial uncoupling protein, putative [Ricinus communis] Length = 305 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGAL IAVANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 127 TGALGIAVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTI 169 >ref|XP_007205615.1| hypothetical protein PRUPE_ppa009102mg [Prunus persica] gi|462401257|gb|EMJ06814.1| hypothetical protein PRUPE_ppa009102mg [Prunus persica] Length = 306 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 128 TGALAITVANPTDLVKVRLQAEGKLPPGAPRRYSGALNAYSTI 170 >dbj|BAL41370.1| uncoupling protein [Arum maculatum] Length = 304 Score = 61.2 bits (147), Expect = 2e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 127 TGALAITVANPTDLVKVRLQAEGKLPPGIPRRYSGALNAYSTI 169 >gb|ACQ42213.1| putative mitochondrial uncoupling protein [Actinidia deliciosa] Length = 193 Score = 61.2 bits (147), Expect = 2e-06 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGA+AIA+ANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 82 TGAVAIAIANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTI 124 >gb|KRH00136.1| hypothetical protein GLYMA_18G195400 [Glycine max] Length = 331 Score = 60.8 bits (146), Expect = 3e-06 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGA+AIAVANP LVKV+LQ EGK P PRR+SG+LNAYSTI Sbjct: 127 TGAMAIAVANPTDLVKVRLQAEGKLPPGVPRRYSGSLNAYSTI 169 >gb|KHN08310.1| Mitochondrial uncoupling protein 3 [Glycine soja] Length = 331 Score = 60.8 bits (146), Expect = 3e-06 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGA+AIAVANP LVKV+LQ EGK P PRR+SG+LNAYSTI Sbjct: 127 TGAMAIAVANPTDLVKVRLQAEGKLPPGVPRRYSGSLNAYSTI 169 >dbj|BAI49703.1| uncoupling protein [Lysichiton camtschatcensis] Length = 304 Score = 60.8 bits (146), Expect = 3e-06 Identities = 33/43 (76%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGALAI VANP LVKV+LQ EGK P PRR+SGALNAYSTI Sbjct: 126 TGALAIIVANPTDLVKVRLQAEGKLPPGVPRRYSGALNAYSTI 168 >ref|XP_003552220.1| PREDICTED: mitochondrial uncoupling protein 1-like [Glycine max] gi|947050606|gb|KRH00135.1| hypothetical protein GLYMA_18G195400 [Glycine max] Length = 305 Score = 60.8 bits (146), Expect = 3e-06 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGA+AIAVANP LVKV+LQ EGK P PRR+SG+LNAYSTI Sbjct: 127 TGAMAIAVANPTDLVKVRLQAEGKLPPGVPRRYSGSLNAYSTI 169 >gb|AAL68563.1|AF452028_1 uncoupling protein 1b [Glycine max] Length = 241 Score = 60.8 bits (146), Expect = 3e-06 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = -1 Query: 133 TGALAIAVANPNSLVKVQLQLEGK*SP--PRRFSGALNAYSTI 11 TGA+AIAVANP LVKV+LQ EGK P PRR+SG+LNAYSTI Sbjct: 87 TGAMAIAVANPTDLVKVRLQAEGKLPPGVPRRYSGSLNAYSTI 129