BLASTX nr result
ID: Papaver30_contig00011549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00011549 (494 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007544061.1| PREDICTED: vegetative cell wall protein gp1-... 62 1e-07 gb|KFO64311.1| hypothetical protein N302_14820, partial [Corvus ... 57 5e-06 >ref|XP_007544061.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Poecilia formosa] Length = 304 Score = 62.4 bits (150), Expect = 1e-07 Identities = 47/127 (37%), Positives = 59/127 (46%), Gaps = 21/127 (16%) Frame = +1 Query: 7 QNFPVHPAPY-SGQNFPVHVCICASVVFSPGQAFPVHPAPY----SGQNFPVHMCICV-- 165 Q PVHP+P S Q+ PVH I V SP ++ PVHP+P S Q+ PVH I V Sbjct: 32 QFIPVHPSPSRSIQSLPVHQSI--PVHPSPSRSIPVHPSPSVHPGSSQSIPVHQSIPVHQ 89 Query: 166 LLVFSPGQAFSVHPAPSSGQNFPVHPAPYSGDNFPQGERCIP--------------RSPS 303 + PG + S+ PS Q PVHP+P S + IP SPS Sbjct: 90 SIPVHPGSSLSIPVPPSPSQFIPVHPSPSSPSQSISPSQSIPVHPGPSQSISPSQSISPS 149 Query: 304 SYFLIHP 324 L+HP Sbjct: 150 QSILVHP 156 >gb|KFO64311.1| hypothetical protein N302_14820, partial [Corvus brachyrhynchos] Length = 76 Score = 57.0 bits (136), Expect = 5e-06 Identities = 37/91 (40%), Positives = 46/91 (50%), Gaps = 8/91 (8%) Frame = +1 Query: 1 SGQNFPVHPAPYSGQNFPVHVCICASVVFSPGQAFPVHPAPYSGQNFPVHMCICVLLVFS 180 S Q+ PVHP+ S Q+ PVH SP Q PVHP+ S Q+ PVH S Sbjct: 3 SSQSIPVHPS--SSQSIPVHP--------SPSQFIPVHPS--SSQSIPVHP--------S 42 Query: 181 PGQAFSVHPAPSSG--------QNFPVHPAP 249 P Q+ VHP+PS Q+ PVHP+P Sbjct: 43 PSQSIPVHPSPSQSTLEHPSPSQSLPVHPSP 73