BLASTX nr result
ID: Papaver30_contig00011335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00011335 (1210 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71935.1| hypothetical protein M569_02822, partial [Genlise... 72 1e-09 ref|XP_012069130.1| PREDICTED: squamous cell carcinoma antigen r... 70 3e-09 ref|XP_010270737.1| PREDICTED: squamous cell carcinoma antigen r... 70 3e-09 gb|KDP40896.1| hypothetical protein JCGZ_24895 [Jatropha curcas] 70 3e-09 ref|XP_012568351.1| PREDICTED: squamous cell carcinoma antigen r... 70 4e-09 ref|XP_011028422.1| PREDICTED: squamous cell carcinoma antigen r... 70 4e-09 ref|XP_002527822.1| Squamous cell carcinoma antigen recognized b... 70 4e-09 ref|XP_004485413.1| PREDICTED: squamous cell carcinoma antigen r... 70 4e-09 ref|XP_004485412.1| PREDICTED: squamous cell carcinoma antigen r... 70 4e-09 ref|XP_004485411.1| PREDICTED: squamous cell carcinoma antigen r... 70 4e-09 ref|XP_010252304.1| PREDICTED: squamous cell carcinoma antigen r... 70 5e-09 ref|XP_010252303.1| PREDICTED: squamous cell carcinoma antigen r... 70 5e-09 gb|KDO42057.1| hypothetical protein CISIN_1g008442mg [Citrus sin... 70 5e-09 gb|KDO42054.1| hypothetical protein CISIN_1g008442mg [Citrus sin... 70 5e-09 gb|KDO42053.1| hypothetical protein CISIN_1g008442mg [Citrus sin... 70 5e-09 gb|KDO42052.1| hypothetical protein CISIN_1g008442mg [Citrus sin... 70 5e-09 ref|XP_006470935.1| PREDICTED: squamous cell carcinoma antigen r... 70 5e-09 ref|XP_006431430.1| hypothetical protein CICLE_v10000238mg [Citr... 70 5e-09 ref|XP_006431429.1| hypothetical protein CICLE_v10000238mg [Citr... 70 5e-09 ref|XP_006431428.1| hypothetical protein CICLE_v10000238mg [Citr... 70 5e-09 >gb|EPS71935.1| hypothetical protein M569_02822, partial [Genlisea aurea] Length = 777 Score = 71.6 bits (174), Expect = 1e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGS+LEAW+GY+ ME++T +ID ARS+YKRC+SKRF GTGSE Sbjct: 448 SGSILEAWQGYIAMEIETGNIDEARSLYKRCYSKRFPGTGSE 489 >ref|XP_012069130.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3 [Jatropha curcas] Length = 833 Score = 70.5 bits (171), Expect = 3e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLEAW+GY+ ME++ HI+ ARSIYKRC+SKR GTGSE Sbjct: 481 SGSMLEAWQGYIAMEIEQGHINEARSIYKRCYSKRLTGTGSE 522 >ref|XP_010270737.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Nelumbo nucifera] Length = 834 Score = 70.5 bits (171), Expect = 3e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLEAW+ Y+ ME++ HI ARSIYKRC+SKRF GTGSE Sbjct: 472 SGSMLEAWQSYIRMEIEAGHIKDARSIYKRCYSKRFSGTGSE 513 >gb|KDP40896.1| hypothetical protein JCGZ_24895 [Jatropha curcas] Length = 819 Score = 70.5 bits (171), Expect = 3e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLEAW+GY+ ME++ HI+ ARSIYKRC+SKR GTGSE Sbjct: 467 SGSMLEAWQGYIAMEIEQGHINEARSIYKRCYSKRLTGTGSE 508 >ref|XP_012568351.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3 isoform X4 [Cicer arietinum] Length = 673 Score = 70.1 bits (170), Expect = 4e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 123 GSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 GSMLEAW GY+ MEV++ HI+ ARSIYKRC+SK+F GTGSE Sbjct: 481 GSMLEAWTGYIAMEVESGHINEARSIYKRCYSKKFSGTGSE 521 >ref|XP_011028422.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Populus euphratica] gi|743938710|ref|XP_011013793.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Populus euphratica] Length = 847 Score = 70.1 bits (170), Expect = 4e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLEAW+G++ ME ++ HI ARSIYKRC+SKRF GTGSE Sbjct: 490 SGSMLEAWQGFIAMETESGHISEARSIYKRCYSKRFPGTGSE 531 >ref|XP_002527822.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] gi|223532746|gb|EEF34525.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] Length = 852 Score = 70.1 bits (170), Expect = 4e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLE W+GY+ ME + HI+ ARSIYKRC+SKRF GTGSE Sbjct: 501 SGSMLEVWQGYITMETELGHINEARSIYKRCYSKRFTGTGSE 542 >ref|XP_004485413.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3 isoform X3 [Cicer arietinum] Length = 821 Score = 70.1 bits (170), Expect = 4e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 123 GSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 GSMLEAW GY+ MEV++ HI+ ARSIYKRC+SK+F GTGSE Sbjct: 479 GSMLEAWTGYIAMEVESGHINEARSIYKRCYSKKFSGTGSE 519 >ref|XP_004485412.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3 isoform X2 [Cicer arietinum] Length = 821 Score = 70.1 bits (170), Expect = 4e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 123 GSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 GSMLEAW GY+ MEV++ HI+ ARSIYKRC+SK+F GTGSE Sbjct: 481 GSMLEAWTGYIAMEVESGHINEARSIYKRCYSKKFSGTGSE 521 >ref|XP_004485411.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3 isoform X1 [Cicer arietinum] Length = 823 Score = 70.1 bits (170), Expect = 4e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 123 GSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 GSMLEAW GY+ MEV++ HI+ ARSIYKRC+SK+F GTGSE Sbjct: 481 GSMLEAWTGYIAMEVESGHINEARSIYKRCYSKKFSGTGSE 521 >ref|XP_010252304.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like isoform X2 [Nelumbo nucifera] gi|719988344|ref|XP_010252305.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like isoform X2 [Nelumbo nucifera] Length = 723 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLEAW+ Y+ ME++ HI ARS+YKRC+SKRF GTGSE Sbjct: 375 SGSMLEAWQSYIRMEIEAGHIKDARSLYKRCYSKRFSGTGSE 416 >ref|XP_010252303.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like isoform X1 [Nelumbo nucifera] Length = 826 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SGSMLEAW+ Y+ ME++ HI ARS+YKRC+SKRF GTGSE Sbjct: 478 SGSMLEAWQSYIRMEIEAGHIKDARSLYKRCYSKRFSGTGSE 519 >gb|KDO42057.1| hypothetical protein CISIN_1g008442mg [Citrus sinensis] Length = 406 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 213 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 254 >gb|KDO42054.1| hypothetical protein CISIN_1g008442mg [Citrus sinensis] gi|641822550|gb|KDO42055.1| hypothetical protein CISIN_1g008442mg [Citrus sinensis] gi|641822551|gb|KDO42056.1| hypothetical protein CISIN_1g008442mg [Citrus sinensis] Length = 438 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 213 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 254 >gb|KDO42053.1| hypothetical protein CISIN_1g008442mg [Citrus sinensis] Length = 442 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 213 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 254 >gb|KDO42052.1| hypothetical protein CISIN_1g008442mg [Citrus sinensis] Length = 565 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 213 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 254 >ref|XP_006470935.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Citrus sinensis] Length = 845 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 493 SGAMLEAWQSYISMEIELGHINEARSIYKRCYSKRFTGTGSE 534 >ref|XP_006431430.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533552|gb|ESR44670.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 849 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 497 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 538 >ref|XP_006431429.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533551|gb|ESR44669.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 871 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 519 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 560 >ref|XP_006431428.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533550|gb|ESR44668.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 683 Score = 69.7 bits (169), Expect = 5e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -2 Query: 126 SGSMLEAWEGYVEMEVQTSHIDSARSIYKRCHSKRFMGTGSE 1 SG+MLEAW+ Y+ ME++ HI+ ARSIYKRC+SKRF GTGSE Sbjct: 458 SGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSE 499