BLASTX nr result
ID: Papaver30_contig00008147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00008147 (572 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, p... 76 1e-11 ref|XP_009773275.1| PREDICTED: hippocampus abundant transcript-l... 72 2e-10 ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-l... 72 2e-10 ref|XP_010032087.1| PREDICTED: hippocampus abundant transcript-l... 70 6e-10 ref|XP_010032085.1| PREDICTED: hippocampus abundant transcript-l... 70 6e-10 ref|XP_010032084.1| PREDICTED: hippocampus abundant transcript-l... 70 6e-10 ref|XP_010067148.1| PREDICTED: hippocampus abundant transcript-l... 70 6e-10 gb|KCW51478.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus g... 70 6e-10 ref|XP_010032083.1| PREDICTED: hippocampus abundant transcript-l... 70 6e-10 ref|XP_010032091.1| PREDICTED: hippocampus abundant transcript-l... 69 2e-09 ref|XP_010032090.1| PREDICTED: hippocampus abundant transcript-l... 69 2e-09 ref|XP_010032089.1| PREDICTED: hippocampus abundant transcript-l... 69 2e-09 gb|KCW51480.1| hypothetical protein EUGRSUZ_J00999 [Eucalyptus g... 69 2e-09 gb|EPS69092.1| hypothetical protein M569_05672, partial [Genlise... 67 5e-09 gb|KHN37831.1| Hippocampus abundant transcript-like protein 1 [G... 65 2e-08 ref|XP_006589383.1| PREDICTED: hippocampus abundant transcript-l... 65 2e-08 ref|XP_003535506.2| PREDICTED: hippocampus abundant transcript-l... 65 2e-08 ref|XP_011032840.1| PREDICTED: hippocampus abundant transcript-l... 64 4e-08 ref|XP_011032839.1| PREDICTED: hippocampus abundant transcript-l... 64 4e-08 ref|XP_002311018.2| hypothetical protein POPTR_0008s02280g [Popu... 64 4e-08 >ref|XP_002524989.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] gi|223535733|gb|EEF37396.1| Hippocampus abundant transcript 1 protein, putative [Ricinus communis] Length = 443 Score = 76.3 bits (186), Expect = 1e-11 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APFDCKGFSI++AS+CMMV+F +A +LKPE+ +K++E E IEAPL+ Sbjct: 390 WFLSSNAPFDCKGFSIIVASLCMMVAFCYACMLKPEQETKNLE----EDIEAPLI 440 >ref|XP_009773275.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X2 [Nicotiana sylvestris] Length = 382 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLLA 403 WFLS APF+CKGFSIL AS+CM+VS Y+A +LK E SK ++ E IEAPLLA Sbjct: 327 WFLSRDAPFNCKGFSILCASLCMVVSLYYACMLKVEAPSKKTFDENAENIEAPLLA 382 >ref|XP_009773274.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Nicotiana sylvestris] Length = 441 Score = 72.0 bits (175), Expect = 2e-10 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLLA 403 WFLS APF+CKGFSIL AS+CM+VS Y+A +LK E SK ++ E IEAPLLA Sbjct: 386 WFLSRDAPFNCKGFSILCASLCMVVSLYYACMLKVEAPSKKTFDENAENIEAPLLA 441 >ref|XP_010032087.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X4 [Eucalyptus grandis] gi|702476593|ref|XP_010032088.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X4 [Eucalyptus grandis] Length = 361 Score = 70.5 bits (171), Expect = 6e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ AS+CM++SF +A LLKPE SS++ + D+ E EAPLL Sbjct: 301 WFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQDNIEEQEAPLL 356 >ref|XP_010032085.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X3 [Eucalyptus grandis] gi|702476584|ref|XP_010032086.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X3 [Eucalyptus grandis] Length = 380 Score = 70.5 bits (171), Expect = 6e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ AS+CM++SF +A LLKPE SS++ + D+ E EAPLL Sbjct: 320 WFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQDNIEEQEAPLL 375 >ref|XP_010032084.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X2 [Eucalyptus grandis] Length = 421 Score = 70.5 bits (171), Expect = 6e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ AS+CM++SF +A LLKPE SS++ + D+ E EAPLL Sbjct: 361 WFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQDNIEEQEAPLL 416 >ref|XP_010067148.1| PREDICTED: hippocampus abundant transcript-like protein 1 [Eucalyptus grandis] gi|629099446|gb|KCW65211.1| hypothetical protein EUGRSUZ_G02698 [Eucalyptus grandis] Length = 459 Score = 70.5 bits (171), Expect = 6e-10 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WF+S APFDCKGFSI+ ASICM+++ +A +LKPEES + D + +EAPLL Sbjct: 398 WFISKSAPFDCKGFSIVCASICMVIALCYACMLKPEESPRQDTPDPEDNLEAPLL 452 >gb|KCW51478.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis] Length = 348 Score = 70.5 bits (171), Expect = 6e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ AS+CM++SF +A LLKPE SS++ + D+ E EAPLL Sbjct: 288 WFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQDNIEEQEAPLL 343 >ref|XP_010032083.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Eucalyptus grandis] gi|629085119|gb|KCW51476.1| hypothetical protein EUGRSUZ_J00997 [Eucalyptus grandis] Length = 450 Score = 70.5 bits (171), Expect = 6e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ AS+CM++SF +A LLKPE SS++ + D+ E EAPLL Sbjct: 390 WFLSDNAPFNCKGFSIVCASVCMVLSFVYACLLKPENWSSQNSDQDNIEEQEAPLL 445 >ref|XP_010032091.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X3 [Eucalyptus grandis] Length = 380 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ A++CM++SF A LLKPE+ SS++ + D+ E EAPLL Sbjct: 320 WFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQDNIEDQEAPLL 375 >ref|XP_010032090.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X2 [Eucalyptus grandis] Length = 450 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ A++CM++SF A LLKPE+ SS++ + D+ E EAPLL Sbjct: 390 WFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQDNIEDQEAPLL 445 >ref|XP_010032089.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Eucalyptus grandis] Length = 500 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ A++CM++SF A LLKPE+ SS++ + D+ E EAPLL Sbjct: 440 WFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQDNIEDQEAPLL 495 >gb|KCW51480.1| hypothetical protein EUGRSUZ_J00999 [Eucalyptus grandis] Length = 523 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/56 (58%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEE-SSKSIEVDDFETIEAPLL 406 WFLS APF+CKGFSI+ A++CM++SF A LLKPE+ SS++ + D+ E EAPLL Sbjct: 463 WFLSDNAPFNCKGFSIVCAAVCMVLSFVFACLLKPEDWSSQNSDQDNIEDQEAPLL 518 >gb|EPS69092.1| hypothetical protein M569_05672, partial [Genlisea aurea] Length = 441 Score = 67.4 bits (163), Expect = 5e-09 Identities = 38/59 (64%), Positives = 43/59 (72%), Gaps = 3/59 (5%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSK---SIEVDDFETIEAPLLA 403 WFLSS APFDCKGFSILLAS+ M+VSF+ A L +SSK + E D E IEAPLLA Sbjct: 383 WFLSSSAPFDCKGFSILLASMGMVVSFFLASTLNLRDSSKKKITGEEDRSENIEAPLLA 441 >gb|KHN37831.1| Hippocampus abundant transcript-like protein 1 [Glycine soja] Length = 442 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APF+CKGFSI+ ASICM++S A LLKP ++S S +++ + E PLL Sbjct: 387 WFLSSNAPFECKGFSIICASICMIISLCFACLLKPADTSSSNDIEGSQ--ETPLL 439 >ref|XP_006589383.1| PREDICTED: hippocampus abundant transcript-like protein 1-like isoform X2 [Glycine max] gi|947086030|gb|KRH34751.1| hypothetical protein GLYMA_10G203700 [Glycine max] Length = 375 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APF+CKGFSI+ ASICM++S A LLKP ++S S +++ + E PLL Sbjct: 320 WFLSSNAPFECKGFSIICASICMIISLCFACLLKPADTSSSNDIEGSQ--ETPLL 372 >ref|XP_003535506.2| PREDICTED: hippocampus abundant transcript-like protein 1-like isoform X1 [Glycine max] gi|947086029|gb|KRH34750.1| hypothetical protein GLYMA_10G203700 [Glycine max] Length = 450 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APF+CKGFSI+ ASICM++S A LLKP ++S S +++ + E PLL Sbjct: 395 WFLSSNAPFECKGFSIICASICMIISLCFACLLKPADTSSSNDIEGSQ--ETPLL 447 >ref|XP_011032840.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X2 [Populus euphratica] Length = 374 Score = 64.3 bits (155), Expect = 4e-08 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APFDCKGFSI++AS+ MM++ A LLKP+E + D + IEAPLL Sbjct: 320 WFLSSTAPFDCKGFSIIVASVSMMIALCFACLLKPDE---KLSHDPEDEIEAPLL 371 >ref|XP_011032839.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Populus euphratica] Length = 444 Score = 64.3 bits (155), Expect = 4e-08 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APFDCKGFSI++AS+ MM++ A LLKP+E + D + IEAPLL Sbjct: 390 WFLSSTAPFDCKGFSIIVASVSMMIALCFACLLKPDE---KLSHDPEDEIEAPLL 441 >ref|XP_002311018.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa] gi|550332227|gb|EEE88385.2| hypothetical protein POPTR_0008s02280g [Populus trichocarpa] Length = 444 Score = 64.3 bits (155), Expect = 4e-08 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -3 Query: 570 WFLSSKAPFDCKGFSILLASICMMVSFYHAMLLKPEESSKSIEVDDFETIEAPLL 406 WFLSS APFDCKGFSI++AS+ MM++ A LLKP+E + D + IEAPLL Sbjct: 390 WFLSSTAPFDCKGFSIIVASVSMMIALCFACLLKPDE---KLSHDPEDEIEAPLL 441