BLASTX nr result
ID: Papaver30_contig00007786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00007786 (534 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008791390.1| PREDICTED: cationic amino acid transporter 3... 60 5e-07 ref|XP_011001714.1| PREDICTED: cationic amino acid transporter 2... 56 9e-06 >ref|XP_008791390.1| PREDICTED: cationic amino acid transporter 3, mitochondrial-like isoform X1 [Phoenix dactylifera] Length = 640 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 532 VGVFVYVFYGRKHSLLLDAVYVSTERADEIYQNSVEYVA 416 +GVFVY+FYGR HS L DAVYV ADEIY+ SVEYVA Sbjct: 602 IGVFVYLFYGRTHSSLTDAVYVPVAHADEIYRTSVEYVA 640 >ref|XP_011001714.1| PREDICTED: cationic amino acid transporter 2, vacuolar-like [Populus euphratica] Length = 641 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 532 VGVFVYVFYGRKHSLLLDAVYVSTERADEIYQNSVEYVA 416 VGV VYVFYGR+HS LLDAVYV ADEIY++S E +A Sbjct: 603 VGVLVYVFYGRRHSSLLDAVYVPASHADEIYRSSGESLA 641