BLASTX nr result
ID: Papaver30_contig00007305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00007305 (534 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010049271.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 95 2e-17 gb|KCW81886.1| hypothetical protein EUGRSUZ_C032522, partial [Eu... 95 2e-17 gb|KCW81785.1| hypothetical protein EUGRSUZ_C031462, partial [Eu... 95 2e-17 ref|XP_002276358.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 95 2e-17 emb|CAN73679.1| hypothetical protein VITISV_021402 [Vitis vinifera] 95 2e-17 ref|XP_009784316.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 95 2e-17 ref|XP_009123260.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [... 95 2e-17 ref|XP_013628713.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [... 95 2e-17 emb|CDY12340.1| BnaA06g20040D [Brassica napus] 95 2e-17 ref|NP_197993.1| PHD finger protein ALFIN-LIKE 4 [Arabidopsis th... 94 3e-17 ref|XP_010493880.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 94 3e-17 ref|XP_010424343.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 94 3e-17 gb|KFK26395.1| hypothetical protein AALP_AA8G243000 [Arabis alpina] 94 3e-17 emb|CDP20538.1| unnamed protein product [Coffea canephora] 94 3e-17 gb|AAC26230.1| similar to Medicago sativa nucleic acid binding p... 94 3e-17 ref|XP_006286540.1| hypothetical protein CARUB_v10001751mg [Caps... 94 3e-17 ref|XP_002874304.1| hypothetical protein ARALYDRAFT_910695 [Arab... 94 3e-17 dbj|BAE98515.1| nucleic acid binding protein - like [Arabidopsis... 94 3e-17 ref|XP_014516537.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-l... 94 4e-17 ref|XP_014516536.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-l... 94 4e-17 >ref|XP_010049271.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Eucalyptus grandis] Length = 128 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 88 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 127 >gb|KCW81886.1| hypothetical protein EUGRSUZ_C032522, partial [Eucalyptus grandis] Length = 87 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 47 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 86 >gb|KCW81785.1| hypothetical protein EUGRSUZ_C031462, partial [Eucalyptus grandis] Length = 133 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 93 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 132 >ref|XP_002276358.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Vitis vinifera] gi|297743032|emb|CBI35899.3| unnamed protein product [Vitis vinifera] Length = 261 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 221 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 260 >emb|CAN73679.1| hypothetical protein VITISV_021402 [Vitis vinifera] Length = 239 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 199 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 238 >ref|XP_009784316.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Nicotiana sylvestris] Length = 246 Score = 94.7 bits (234), Expect = 2e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 206 WICCDICERWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 245 >ref|XP_009123260.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [Brassica rapa] Length = 254 Score = 94.7 bits (234), Expect = 2e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CEVWFHGKCVKITPARAEHIKQYKCP+CSNKR+R Sbjct: 214 WICCDVCEVWFHGKCVKITPARAEHIKQYKCPACSNKRAR 253 >ref|XP_013628713.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [Brassica oleracea var. oleracea] gi|923743008|ref|XP_013671838.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [Brassica napus] gi|674945488|emb|CDX87962.1| BnaC03g54340D [Brassica napus] Length = 254 Score = 94.7 bits (234), Expect = 2e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CEVWFHGKCVKITPARAEHIKQYKCP+CSNKR+R Sbjct: 214 WICCDVCEVWFHGKCVKITPARAEHIKQYKCPACSNKRAR 253 >emb|CDY12340.1| BnaA06g20040D [Brassica napus] Length = 254 Score = 94.7 bits (234), Expect = 2e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CEVWFHGKCVKITPARAEHIKQYKCP+CSNKR+R Sbjct: 214 WICCDVCEVWFHGKCVKITPARAEHIKQYKCPACSNKRAR 253 >ref|NP_197993.1| PHD finger protein ALFIN-LIKE 4 [Arabidopsis thaliana] gi|73921146|sp|O81488.2|ALFL4_ARATH RecName: Full=PHD finger protein ALFIN-LIKE 4; Short=Protein AL4; Contains: RecName: Full=PHD finger protein ALFIN-LIKE 4, N-terminally processed gi|21592780|gb|AAM64729.1| nucleic acid binding protein-like [Arabidopsis thaliana] gi|87116584|gb|ABD19656.1| At5g26210 [Arabidopsis thaliana] gi|225898935|dbj|BAH30598.1| hypothetical protein [Arabidopsis thaliana] gi|332006154|gb|AED93537.1| alfin-like 4 protein [Arabidopsis thaliana] Length = 255 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 215 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 254 >ref|XP_010493880.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Camelina sativa] Length = 259 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 219 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 258 >ref|XP_010424343.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like, partial [Camelina sativa] Length = 102 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 62 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 101 >gb|KFK26395.1| hypothetical protein AALP_AA8G243000 [Arabis alpina] Length = 254 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 214 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 253 >emb|CDP20538.1| unnamed protein product [Coffea canephora] Length = 248 Score = 94.4 bits (233), Expect = 3e-17 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE WFHGKCVKITPARAEHIKQYKCPSCSNKRSR Sbjct: 208 WICCDVCERWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 247 >gb|AAC26230.1| similar to Medicago sativa nucleic acid binding protein Alfin-1 (GB:L07291) [Arabidopsis thaliana] Length = 251 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 211 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 250 >ref|XP_006286540.1| hypothetical protein CARUB_v10001751mg [Capsella rubella] gi|482555246|gb|EOA19438.1| hypothetical protein CARUB_v10001751mg [Capsella rubella] Length = 259 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 219 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 258 >ref|XP_002874304.1| hypothetical protein ARALYDRAFT_910695 [Arabidopsis lyrata subsp. lyrata] gi|297320141|gb|EFH50563.1| hypothetical protein ARALYDRAFT_910695 [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 216 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 255 >dbj|BAE98515.1| nucleic acid binding protein - like [Arabidopsis thaliana] Length = 255 Score = 94.4 bits (233), Expect = 3e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCD+CE+WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 215 WICCDLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 254 >ref|XP_014516537.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X2 [Vigna radiata var. radiata] Length = 252 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 212 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 251 >ref|XP_014516536.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like isoform X1 [Vigna radiata var. radiata] Length = 253 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +1 Query: 1 WICCDICEVWFHGKCVKITPARAEHIKQYKCPSCSNKRSR 120 WICCDICE WFHGKCVKITPARAEHIKQYKCPSCSNKR+R Sbjct: 213 WICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 252