BLASTX nr result
ID: Papaver30_contig00004654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00004654 (429 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524285.1| phosphoric diester hydrolase, putative [Rici... 60 8e-07 ref|XP_012080754.1| PREDICTED: tubby-like F-box protein 8 [Jatro... 59 1e-06 ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8 [Vitis... 58 2e-06 emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera] 58 2e-06 ref|XP_011044216.1| PREDICTED: tubby-like F-box protein 8 isofor... 57 5e-06 ref|XP_011044215.1| PREDICTED: tubby-like F-box protein 8 isofor... 57 5e-06 ref|XP_002306697.1| hypothetical protein POPTR_0005s21450g [Popu... 57 5e-06 ref|XP_009351377.1| PREDICTED: tubby-like F-box protein 8 [Pyrus... 57 7e-06 ref|XP_008381822.1| PREDICTED: tubby-like F-box protein 8 [Malus... 57 7e-06 ref|XP_008237579.1| PREDICTED: tubby-like F-box protein 8 [Prunu... 57 7e-06 ref|XP_004290516.1| PREDICTED: tubby-like F-box protein 8 [Fraga... 57 7e-06 ref|XP_007201025.1| hypothetical protein PRUPE_ppa006121mg [Prun... 57 7e-06 ref|NP_001280941.1| tubby-like F-box protein 8 [Malus domestica]... 57 7e-06 >ref|XP_002524285.1| phosphoric diester hydrolase, putative [Ricinus communis] gi|223536376|gb|EEF38025.1| phosphoric diester hydrolase, putative [Ricinus communis] Length = 424 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSHS 427 MSFRSI+RD+RDGFGSLSRRSFDLRL H GKSHS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFDLRLPGHHRGKSHS 36 >ref|XP_012080754.1| PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] gi|802658982|ref|XP_012080755.1| PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] gi|802658986|ref|XP_012080756.1| PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] gi|802658990|ref|XP_012080757.1| PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] gi|802658994|ref|XP_012080758.1| PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] gi|802658998|ref|XP_012080759.1| PREDICTED: tubby-like F-box protein 8 [Jatropha curcas] gi|643720374|gb|KDP30771.1| hypothetical protein JCGZ_15200 [Jatropha curcas] Length = 424 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/36 (83%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSHS 427 MSFRSI+RDVRDGFGSLSRRSF+LRL H GKSHS Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFELRLPGHHRGKSHS 36 >ref|XP_002267914.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] gi|731430681|ref|XP_010665127.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] gi|731430683|ref|XP_010665128.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] gi|731430685|ref|XP_010665129.1| PREDICTED: tubby-like F-box protein 8 [Vitis vinifera] Length = 425 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/35 (82%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSFD+RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSH 35 >emb|CAN82256.1| hypothetical protein VITISV_009404 [Vitis vinifera] Length = 380 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/35 (82%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSFD+RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFDVRLPGHHRGKSH 35 >ref|XP_011044216.1| PREDICTED: tubby-like F-box protein 8 isoform X2 [Populus euphratica] Length = 423 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSHS 427 MSFRSI+RD+RDGFGSLSRRSF++RL H GKSHS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFEVRLPGHHRGKSHS 36 >ref|XP_011044215.1| PREDICTED: tubby-like F-box protein 8 isoform X1 [Populus euphratica] Length = 431 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSHS 427 MSFRSI+RD+RDGFGSLSRRSF++RL H GKSHS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFEVRLPGHHRGKSHS 36 >ref|XP_002306697.1| hypothetical protein POPTR_0005s21450g [Populus trichocarpa] gi|222856146|gb|EEE93693.1| hypothetical protein POPTR_0005s21450g [Populus trichocarpa] Length = 423 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSHS 427 MSFRSI+RD+RDGFGSLSRRSF++RL H GKSHS Sbjct: 1 MSFRSIVRDMRDGFGSLSRRSFEVRLPGHHRGKSHS 36 >ref|XP_009351377.1| PREDICTED: tubby-like F-box protein 8 [Pyrus x bretschneideri] Length = 426 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSF++RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSH 35 >ref|XP_008381822.1| PREDICTED: tubby-like F-box protein 8 [Malus domestica] Length = 426 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSF++RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSH 35 >ref|XP_008237579.1| PREDICTED: tubby-like F-box protein 8 [Prunus mume] Length = 426 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSF++RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSH 35 >ref|XP_004290516.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] gi|764533036|ref|XP_011458506.1| PREDICTED: tubby-like F-box protein 8 [Fragaria vesca subsp. vesca] Length = 429 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSF++RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSH 35 >ref|XP_007201025.1| hypothetical protein PRUPE_ppa006121mg [Prunus persica] gi|462396425|gb|EMJ02224.1| hypothetical protein PRUPE_ppa006121mg [Prunus persica] Length = 426 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSF++RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSH 35 >ref|NP_001280941.1| tubby-like F-box protein 8 [Malus domestica] gi|302399095|gb|ADL36842.1| TLP domain class transcription factor [Malus domestica] Length = 426 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/35 (80%), Positives = 31/35 (88%), Gaps = 3/35 (8%) Frame = +2 Query: 329 MSFRSIIRDVRDGFGSLSRRSFDLRL---HTGKSH 424 MSFRSI+RDVRDGFGSLSRRSF++RL H GKSH Sbjct: 1 MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHRGKSH 35