BLASTX nr result
ID: Papaver30_contig00000753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00000753 (472 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sy... 57 4e-06 >ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris] Length = 567 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +1 Query: 319 VVSKSSPLHVHDENLQVAHSNCEGTLYPELCISTLASLFPGTSLKRKSIAE 471 V +++ +HVH +N+Q+A S+CEGTL+PELC+STL+S FP +L RKSIAE Sbjct: 40 VATRTPHIHVH-KNIQIAQSHCEGTLHPELCVSTLSS-FP--NLHRKSIAE 86