BLASTX nr result
ID: Papaver30_contig00000434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver30_contig00000434 (429 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255673.1| PREDICTED: PGR5-like protein 1A, chloroplast... 65 3e-08 ref|XP_012847434.1| PREDICTED: PGR5-like protein 1A, chloroplast... 59 1e-06 ref|XP_012854383.1| PREDICTED: PGR5-like protein 1A, chloroplast... 58 3e-06 >ref|XP_010255673.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Nelumbo nucifera] Length = 309 Score = 64.7 bits (156), Expect = 3e-08 Identities = 41/90 (45%), Positives = 49/90 (54%) Frame = -2 Query: 272 MVTQLGFAINSPRLSFSPPLLXXXXXXXXXXXXXXXXXXXXSAKFIDHKSLARRRVFIIS 93 MVT LGF + SPRL F+ L S F + R R+FI+ Sbjct: 1 MVTALGFTLTSPRLFFTQ-LRRPFVSSPRDHFSQFTAHHRSSIPFTSFRLSPRHRLFILP 59 Query: 92 AKAADQQQGQASEDEVIDSNVLQYCSIDKK 3 KAADQQ GQA+EDEV+DS +L YCSIDKK Sbjct: 60 PKAADQQ-GQATEDEVVDSKILPYCSIDKK 88 >ref|XP_012847434.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Erythranthe guttatus] gi|604316768|gb|EYU28953.1| hypothetical protein MIMGU_mgv1a010076mg [Erythranthe guttata] Length = 323 Score = 58.9 bits (141), Expect = 1e-06 Identities = 38/93 (40%), Positives = 45/93 (48%), Gaps = 3/93 (3%) Frame = -2 Query: 272 MVTQLGFAINSPRL---SFSPPLLXXXXXXXXXXXXXXXXXXXXSAKFIDHKSLARRRVF 102 M +LGFA PRL F P + +F K RRR+ Sbjct: 1 MAAKLGFAAAKPRLLTAQFRNPFVSVSSLPTSAPRVHSI-------QFGPRKLSLRRRLV 53 Query: 101 IISAKAADQQQGQASEDEVIDSNVLQYCSIDKK 3 +IS KA Q GQ EDEV+DSNVLQYCS+DKK Sbjct: 54 VISPKATADQPGQIQEDEVVDSNVLQYCSLDKK 86 >ref|XP_012854383.1| PREDICTED: PGR5-like protein 1A, chloroplastic [Erythranthe guttatus] gi|604303842|gb|EYU23230.1| hypothetical protein MIMGU_mgv1a010060mg [Erythranthe guttata] Length = 323 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -2 Query: 143 KFIDHKSLARRRVFIISAKAADQQQGQASEDEVIDSNVLQYCSIDKK 3 +F K RRR+ +IS KA Q GQ EDEV+DSNVLQYCS+DKK Sbjct: 40 QFGPRKLSLRRRLVVISPKATADQPGQIQEDEVVDSNVLQYCSLDKK 86