BLASTX nr result
ID: Papaver29_contig00064639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00064639 (512 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010938166.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 ref|XP_010938165.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 gb|KQK92190.1| hypothetical protein SETIT_034076mg [Setaria ital... 59 1e-06 ref|XP_010229054.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 gb|EEE58472.1| hypothetical protein OsJ_09725 [Oryza sativa Japo... 59 1e-06 gb|EEC74662.1| hypothetical protein OsI_10332 [Oryza sativa Indi... 59 1e-06 ref|XP_004985395.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 ref|XP_004985393.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 ref|XP_004985392.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 gb|EMT32010.1| Calmodulin-binding transcription activator 3 [Aeg... 59 1e-06 ref|XP_003558617.1| PREDICTED: calmodulin-binding transcription ... 59 1e-06 ref|XP_002465719.1| hypothetical protein SORBIDRAFT_01g044480 [S... 59 1e-06 ref|NP_001049230.1| Os03g0191000 [Oryza sativa Japonica Group] g... 59 1e-06 gb|ABF94398.1| anther ethylene-upregulated protein ER1, putative... 59 1e-06 ref|XP_010680540.1| PREDICTED: calmodulin-binding transcription ... 59 2e-06 ref|XP_010680539.1| PREDICTED: calmodulin-binding transcription ... 59 2e-06 ref|XP_008644876.1| PREDICTED: calmodulin-binding transcription ... 59 2e-06 ref|XP_008651928.1| PREDICTED: calmodulin-binding transcription ... 59 2e-06 ref|XP_008651911.1| PREDICTED: calmodulin-binding transcription ... 59 2e-06 gb|EEE50856.1| hypothetical protein OsJ_31300 [Oryza sativa Japo... 59 2e-06 >ref|XP_010938166.1| PREDICTED: calmodulin-binding transcription activator 1-like isoform X2 [Elaeis guineensis] Length = 1103 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 22/70 (31%) Frame = -1 Query: 146 FHQLSHGFQMLTTFDVYIEK----------------------AHVRGHQVRKHYKKIIWS 33 FH++SH + L T V I++ AHVRGHQVRKHYKK++WS Sbjct: 929 FHRISHFNEALHTAAVKIQQKYRGWKGRKEFLKIRDRIVKIQAHVRGHQVRKHYKKVVWS 988 Query: 32 VGIVEKAILR 3 V IVEKAILR Sbjct: 989 VSIVEKAILR 998 >ref|XP_010938165.1| PREDICTED: calmodulin-binding transcription activator 1-like isoform X1 [Elaeis guineensis] Length = 1104 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 22/70 (31%) Frame = -1 Query: 146 FHQLSHGFQMLTTFDVYIEK----------------------AHVRGHQVRKHYKKIIWS 33 FH++SH + L T V I++ AHVRGHQVRKHYKK++WS Sbjct: 930 FHRISHFNEALHTAAVKIQQKYRGWKGRKEFLKIRDRIVKIQAHVRGHQVRKHYKKVVWS 989 Query: 32 VGIVEKAILR 3 V IVEKAILR Sbjct: 990 VSIVEKAILR 999 >gb|KQK92190.1| hypothetical protein SETIT_034076mg [Setaria italica] Length = 994 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 844 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 872 >ref|XP_010229054.1| PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 [Brachypodium distachyon] Length = 834 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 684 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 712 >gb|EEE58472.1| hypothetical protein OsJ_09725 [Oryza sativa Japonica Group] Length = 868 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 717 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 745 >gb|EEC74662.1| hypothetical protein OsI_10332 [Oryza sativa Indica Group] Length = 989 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 838 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 866 >ref|XP_004985395.1| PREDICTED: calmodulin-binding transcription activator 3-like isoform X3 [Setaria italica] Length = 834 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 684 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 712 >ref|XP_004985393.1| PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 [Setaria italica] Length = 1034 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 884 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 912 >ref|XP_004985392.1| PREDICTED: calmodulin-binding transcription activator 3-like isoform X1 [Setaria italica] Length = 1035 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 885 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 913 >gb|EMT32010.1| Calmodulin-binding transcription activator 3 [Aegilops tauschii] Length = 1095 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 944 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 972 >ref|XP_003558617.1| PREDICTED: calmodulin-binding transcription activator 1-like isoform X1 [Brachypodium distachyon] gi|944087836|gb|KQK23188.1| hypothetical protein BRADI_1g71810 [Brachypodium distachyon] Length = 1034 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 884 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 912 >ref|XP_002465719.1| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor] gi|241919573|gb|EER92717.1| hypothetical protein SORBIDRAFT_01g044480 [Sorghum bicolor] Length = 994 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 844 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 872 >ref|NP_001049230.1| Os03g0191000 [Oryza sativa Japonica Group] gi|113547701|dbj|BAF11144.1| Os03g0191000 [Oryza sativa Japonica Group] gi|937907797|dbj|BAS82717.1| Os03g0191000 [Oryza sativa Japonica Group] Length = 1029 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 878 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 906 >gb|ABF94398.1| anther ethylene-upregulated protein ER1, putative, expressed [Oryza sativa Japonica Group] Length = 1029 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 878 QAHVRGHQVRKHYRKIIWSVGIVEKVILR 906 >ref|XP_010680540.1| PREDICTED: calmodulin-binding transcription activator 3 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 913 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHYKK +WSVGI+EKAILR Sbjct: 772 QAHVRGHQVRKHYKKFVWSVGIMEKAILR 800 >ref|XP_010680539.1| PREDICTED: calmodulin-binding transcription activator 3 isoform X1 [Beta vulgaris subsp. vulgaris] gi|870857222|gb|KMT08782.1| hypothetical protein BVRB_6g135060 [Beta vulgaris subsp. vulgaris] Length = 1025 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHYKK +WSVGI+EKAILR Sbjct: 884 QAHVRGHQVRKHYKKFVWSVGIMEKAILR 912 >ref|XP_008644876.1| PREDICTED: calmodulin-binding transcription activator 3-like isoform X1 [Zea mays] Length = 1021 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KI+WSVGIVEK ILR Sbjct: 874 QAHVRGHQVRKHYRKIVWSVGIVEKVILR 902 >ref|XP_008651928.1| PREDICTED: calmodulin-binding transcription activator 2-like isoform X3 [Zea mays] Length = 899 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 753 QAHVRGHQVRKHYRKIIWSVGIVEKIILR 781 >ref|XP_008651911.1| PREDICTED: calmodulin-binding transcription activator 1-like isoform X1 [Zea mays] Length = 1026 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KIIWSVGIVEK ILR Sbjct: 880 QAHVRGHQVRKHYRKIIWSVGIVEKIILR 908 >gb|EEE50856.1| hypothetical protein OsJ_31300 [Oryza sativa Japonica Group] Length = 1037 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 89 KAHVRGHQVRKHYKKIIWSVGIVEKAILR 3 +AHVRGHQVRKHY+KI+WSVGIVEK ILR Sbjct: 886 QAHVRGHQVRKHYRKIVWSVGIVEKVILR 914