BLASTX nr result
ID: Papaver29_contig00064597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00064597 (505 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004501444.1| PREDICTED: probable 28S rRNA (cytosine-C(5))... 57 5e-06 >ref|XP_004501444.1| PREDICTED: probable 28S rRNA (cytosine-C(5))-methyltransferase [Cicer arietinum] Length = 505 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -3 Query: 395 VEKDDIVPDLLLVWTGTDLHDHPLVKNESVFLQ 297 V+KDD++PDLL++ GTDLHDHPLVKN S+FLQ Sbjct: 196 VQKDDLIPDLLILPPGTDLHDHPLVKNGSIFLQ 228