BLASTX nr result
ID: Papaver29_contig00063730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00063730 (415 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014504613.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 8e-07 gb|KOM46740.1| hypothetical protein LR48_Vigan07g044400 [Vigna a... 60 8e-07 ref|XP_007141608.1| hypothetical protein PHAVU_008G210300g [Phas... 60 8e-07 gb|KRH14720.1| hypothetical protein GLYMA_14G044500 [Glycine max] 59 1e-06 gb|KRH14719.1| hypothetical protein GLYMA_14G044500 [Glycine max] 59 1e-06 gb|KRH14718.1| hypothetical protein GLYMA_14G044500 [Glycine max] 59 1e-06 gb|KHM99107.1| Ubiquitin carboxyl-terminal hydrolase 12 [Glycine... 59 1e-06 ref|XP_003545531.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 59 1e-06 gb|KHN38466.1| Ubiquitin carboxyl-terminal hydrolase 12 [Glycine... 58 3e-06 ref|XP_006575589.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 3e-06 ref|XP_003519464.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 58 3e-06 ref|XP_014517243.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 4e-06 ref|XP_009795287.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 49 6e-06 ref|XP_009596283.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 52 8e-06 >ref|XP_014504613.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12 [Vigna radiata var. radiata] Length = 1118 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PS+ +F WKIDNFS++ NS LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 49 VEDPSSTRFTWKIDNFSRM---NSKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 102 >gb|KOM46740.1| hypothetical protein LR48_Vigan07g044400 [Vigna angularis] Length = 1102 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PS+ +F WKIDNFS++ NS LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 33 VEDPSSTRFTWKIDNFSRM---NSKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 86 >ref|XP_007141608.1| hypothetical protein PHAVU_008G210300g [Phaseolus vulgaris] gi|561014741|gb|ESW13602.1| hypothetical protein PHAVU_008G210300g [Phaseolus vulgaris] Length = 1118 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PS+ +F WKIDNFS++ NS LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 49 VEDPSSTRFTWKIDNFSRM---NSKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 102 >gb|KRH14720.1| hypothetical protein GLYMA_14G044500 [Glycine max] Length = 1096 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKIDNFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 50 VEDPSTSRFTWKIDNFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 103 >gb|KRH14719.1| hypothetical protein GLYMA_14G044500 [Glycine max] Length = 1118 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKIDNFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 50 VEDPSTSRFTWKIDNFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 103 >gb|KRH14718.1| hypothetical protein GLYMA_14G044500 [Glycine max] Length = 1117 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKIDNFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 49 VEDPSTSRFTWKIDNFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 102 >gb|KHM99107.1| Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] Length = 1151 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKIDNFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 92 VEDPSTSRFTWKIDNFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 145 >ref|XP_003545531.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Glycine max] Length = 1126 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/57 (49%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKIDNFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 50 VEDPSTSRFTWKIDNFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 103 >gb|KHN38466.1| Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] Length = 1084 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKI+NFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 50 VEDPSTSRFTWKIENFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 103 >ref|XP_006575589.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X2 [Glycine max] gi|947125196|gb|KRH73402.1| hypothetical protein GLYMA_02G271500 [Glycine max] Length = 1117 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKI+NFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 49 VEDPSTSRFTWKIENFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 102 >ref|XP_003519464.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like isoform X1 [Glycine max] gi|947125197|gb|KRH73403.1| hypothetical protein GLYMA_02G271500 [Glycine max] Length = 1118 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 VE PST +F WKI+NFS++ N+ LYS++F G KW+ LI+PKG+ ++S+ L Sbjct: 50 VEDPSTSRFTWKIENFSRM---NTKKLYSEIFVVGGYKWRVLIFPKGNNVDYLSMYL 103 >ref|XP_014517243.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Vigna radiata var. radiata] Length = 1027 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 4/66 (6%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSG----KVFISVS 282 VE P + +F W+IDNFS+L N+ LYSD+F G KW+ LI+PKG+ +++ V+ Sbjct: 49 VEDPPSSRFTWRIDNFSRL---NTKKLYSDIFVVGGYKWRVLIFPKGNNVDYLSMYLDVA 105 Query: 283 LSSRLR 300 S+RL+ Sbjct: 106 DSARLK 111 >ref|XP_009795287.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Nicotiana sylvestris] Length = 1123 Score = 48.9 bits (115), Expect(2) = 6e-06 Identities = 25/57 (43%), Positives = 34/57 (59%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 V+ P +F W IDNFS+L LYS+VFS KW+ LI+PKG+ +S+ L Sbjct: 54 VDEPQASRFTWTIDNFSRLSVKK---LYSEVFSVGSYKWRVLIFPKGNNVDCLSMYL 107 Score = 27.7 bits (60), Expect(2) = 6e-06 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +2 Query: 266 CLSVYLSRQDSAKFPVN----LDYILTITNQTDPK 358 CLS+YL DSA P + L + NQ +PK Sbjct: 102 CLSMYLDVADSATLPYGWSRYAQFSLAVVNQVNPK 136 >ref|XP_009596283.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Nicotiana tomentosiformis] Length = 369 Score = 52.4 bits (124), Expect(2) = 8e-06 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = +1 Query: 115 VELPSTVKFIWKIDNFSKLYSNNSAYLYSDVFSAAGAKWKGLIYPKGSGKVFISVSL 285 V+ P++ +F W IDNFS+L N LYS+VF+ G KW+ LI+PKG+ +S+ L Sbjct: 233 VDDPASAQFTWTIDNFSRL---NVKKLYSEVFNVGGYKWRILIFPKGNKVDCLSIYL 286 Score = 23.9 bits (50), Expect(2) = 8e-06 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +2 Query: 266 CLSVYLSRQDSAKFPVN----LDYILTITNQTDPK 358 CLS+YL DSA P + L + NQ K Sbjct: 281 CLSIYLDVADSASLPYGWSKYAQFSLAVHNQIQNK 315