BLASTX nr result
ID: Papaver29_contig00062734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00062734 (768 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106767.1| hypothetical protein L484_020789 [Morus nota... 58 8e-06 >ref|XP_010106767.1| hypothetical protein L484_020789 [Morus notabilis] gi|587924435|gb|EXC11734.1| hypothetical protein L484_020789 [Morus notabilis] Length = 211 Score = 57.8 bits (138), Expect = 8e-06 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = +3 Query: 465 WKKNMYSKGAH*PPIKSVLCNFVVYYFSLFKAPT*VTKITQKKIRSFLWSSAGGQKGCS* 644 WK + SKG I+SVL + +YY SLFK P V ++ ++ +R+FLW + G K S Sbjct: 32 WKNSFLSKGGRLTLIQSVLASIPIYYMSLFKIPNSVVEVLERVMRTFLWDNQDGSKSKSL 91 Query: 645 VNRDI---KDVEGLTIKNLQ 695 V DI K G I+NL+ Sbjct: 92 VAWDIVMSKQKGGFGIRNLK 111