BLASTX nr result
ID: Papaver29_contig00062686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00062686 (488 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_003539003.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_010912918.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 >ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] gi|947075538|gb|KRH24378.1| hypothetical protein GLYMA_12G037500 [Glycine max] Length = 711 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 139 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLA 29 DPI +FFKTR F S+DP EG+++LQKNRR +WHLA Sbjct: 96 DPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRISWHLA 132 >ref|XP_003539003.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] gi|734418923|gb|KHN39840.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] gi|947080561|gb|KRH29350.1| hypothetical protein GLYMA_11G111200 [Glycine max] Length = 703 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 139 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLA 29 DPI +FFKTR F S+DP EG+++LQKNRR +WHLA Sbjct: 88 DPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRISWHLA 124 >ref|XP_008808163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Phoenix dactylifera] Length = 744 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 139 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLADIKSMDTIE 2 DPI FFK+R+E + DP EGR+ LQ+NRRS WH+AD++S D E Sbjct: 120 DPIRNFFKSRSE--TRDPKREGRLTLQRNRRSTWHIADLQSDDIEE 163 >ref|XP_008808162.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Phoenix dactylifera] Length = 756 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 139 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLADIKSMDTIE 2 DPI FFK+R+E + DP EGR+ LQ+NRRS WH+AD++S D E Sbjct: 120 DPIRNFFKSRSE--TRDPKREGRLTLQRNRRSTWHIADLQSDDIEE 163 >ref|XP_010912918.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Elaeis guineensis] Length = 738 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -2 Query: 139 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLADIKSMDTIE 2 DPI FFK+R+E ++DP EGR+ LQ+NRRS+WH+AD +S D E Sbjct: 117 DPILNFFKSRSE--TQDPKREGRLTLQRNRRSSWHIADFESDDLEE 160