BLASTX nr result
ID: Papaver29_contig00062595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00062595 (793 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346419.1| PREDICTED: B3 domain-containing protein At3g... 81 1e-12 ref|XP_013746911.1| PREDICTED: B3 domain-containing protein At5g... 80 2e-12 ref|XP_009123694.1| PREDICTED: B3 domain-containing protein At5g... 80 2e-12 emb|CDY02412.1| BnaA02g23210D [Brassica napus] 80 2e-12 emb|CDY21256.1| BnaC02g28670D [Brassica napus] 80 2e-12 ref|XP_004230784.1| PREDICTED: B3 domain-containing protein At3g... 80 2e-12 ref|XP_010520114.1| PREDICTED: B3 domain-containing protein At5g... 79 3e-12 ref|XP_008788064.1| PREDICTED: B3 domain-containing protein Os06... 79 4e-12 ref|XP_010922413.1| PREDICTED: B3 domain-containing protein Os06... 78 6e-12 ref|XP_010922411.1| PREDICTED: B3 domain-containing protein Os06... 78 6e-12 ref|XP_009367366.1| PREDICTED: B3 domain-containing protein At5g... 78 6e-12 ref|XP_008444633.1| PREDICTED: B3 domain-containing protein At5g... 78 6e-12 ref|XP_013620049.1| PREDICTED: B3 domain-containing protein At5g... 77 1e-11 ref|XP_011649586.1| PREDICTED: B3 domain-containing protein At3g... 77 1e-11 ref|XP_011458939.1| PREDICTED: B3 domain-containing protein At5g... 77 1e-11 gb|KGN62530.1| hypothetical protein Csa_2G359985 [Cucumis sativus] 77 1e-11 gb|KJB14568.1| hypothetical protein B456_002G131600 [Gossypium r... 77 1e-11 gb|KJB14567.1| hypothetical protein B456_002G131600 [Gossypium r... 77 1e-11 ref|XP_012466565.1| PREDICTED: B3 domain-containing protein At5g... 77 1e-11 gb|EAY88816.1| hypothetical protein OsI_10288 [Oryza sativa Indi... 77 1e-11 >ref|XP_006346419.1| PREDICTED: B3 domain-containing protein At3g19184-like [Solanum tuberosum] Length = 224 Score = 80.9 bits (198), Expect = 1e-12 Identities = 37/61 (60%), Positives = 44/61 (72%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKTHLPK D VT++DE GD+F+T YLA K GLSG W FA H L++GDA VF+ P Sbjct: 150 FCKTHLPKHDEYVTLVDENGDEFQTKYLALKTGLSGGWRGFALDHELVDGDALVFQLVAP 209 Query: 184 T 186 T Sbjct: 210 T 210 >ref|XP_013746911.1| PREDICTED: B3 domain-containing protein At5g42700 [Brassica napus] Length = 227 Score = 79.7 bits (195), Expect = 2e-12 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC++ L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +P Sbjct: 149 FCRSELQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRP 208 Query: 184 TL 189 T+ Sbjct: 209 TV 210 >ref|XP_009123694.1| PREDICTED: B3 domain-containing protein At5g42700 [Brassica rapa] gi|923701117|ref|XP_013659682.1| PREDICTED: B3 domain-containing protein At5g42700-like [Brassica napus] Length = 266 Score = 79.7 bits (195), Expect = 2e-12 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC++ L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +P Sbjct: 188 FCRSELQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRP 247 Query: 184 TL 189 T+ Sbjct: 248 TV 249 >emb|CDY02412.1| BnaA02g23210D [Brassica napus] Length = 232 Score = 79.7 bits (195), Expect = 2e-12 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC++ L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +P Sbjct: 154 FCRSELQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRP 213 Query: 184 TL 189 T+ Sbjct: 214 TV 215 >emb|CDY21256.1| BnaC02g28670D [Brassica napus] Length = 225 Score = 79.7 bits (195), Expect = 2e-12 Identities = 34/62 (54%), Positives = 47/62 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC++ L K+D +T++DEEG++FET YLAK+ GLSG W+ FA H L+ GDA VFE +P Sbjct: 147 FCRSELQKQDGVITLIDEEGEEFETVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRP 206 Query: 184 TL 189 T+ Sbjct: 207 TV 208 >ref|XP_004230784.1| PREDICTED: B3 domain-containing protein At3g19184 [Solanum lycopersicum] Length = 224 Score = 79.7 bits (195), Expect = 2e-12 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKTHLPK D +T++DE GD+F+T YLA K GLSG W +A H LI+GDA VF+ P Sbjct: 150 FCKTHLPKHDEYITLVDENGDEFQTKYLALKTGLSGGWRGYALDHELIDGDALVFQLVAP 209 Query: 184 T 186 T Sbjct: 210 T 210 >ref|XP_010520114.1| PREDICTED: B3 domain-containing protein At5g42700-like [Tarenaya hassleriana] Length = 222 Score = 79.3 bits (194), Expect = 3e-12 Identities = 33/62 (53%), Positives = 49/62 (79%) Frame = +1 Query: 1 RFCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTK 180 +FC++HLPK+D+ +T++DEEG+ +ET YLA+K GLSG W+ FA H L +GDA VF+ + Sbjct: 147 QFCRSHLPKQDSAMTLIDEEGEVYETIYLARKTGLSGGWLGFAVAHDLADGDALVFQLVR 206 Query: 181 PT 186 P+ Sbjct: 207 PS 208 >ref|XP_008788064.1| PREDICTED: B3 domain-containing protein Os06g0194400 [Phoenix dactylifera] gi|672129120|ref|XP_008788065.1| PREDICTED: B3 domain-containing protein Os06g0194400 [Phoenix dactylifera] Length = 226 Score = 79.0 bits (193), Expect = 4e-12 Identities = 34/61 (55%), Positives = 45/61 (73%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC HLP+KD +T++DE GD+F++ YLA K GLSG W F+ YH L++GDA VF+ KP Sbjct: 151 FCTKHLPRKDTMMTLVDENGDEFKSLYLAPKNGLSGGWRGFSIYHELVDGDALVFQLVKP 210 Query: 184 T 186 T Sbjct: 211 T 211 >ref|XP_010922413.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform X2 [Elaeis guineensis] Length = 225 Score = 78.2 bits (191), Expect = 6e-12 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC HLP+KD +T++DE GD+F++ YLA K GLSG W F+ YH L++GDA +F+ KP Sbjct: 150 FCTKHLPRKDTMMTLVDENGDEFKSLYLAPKNGLSGGWRGFSIYHELVDGDALIFQLIKP 209 Query: 184 T 186 T Sbjct: 210 T 210 >ref|XP_010922411.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Elaeis guineensis] gi|743787416|ref|XP_010922412.1| PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Elaeis guineensis] Length = 226 Score = 78.2 bits (191), Expect = 6e-12 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC HLP+KD +T++DE GD+F++ YLA K GLSG W F+ YH L++GDA +F+ KP Sbjct: 151 FCTKHLPRKDTMMTLVDENGDEFKSLYLAPKNGLSGGWRGFSIYHELVDGDALIFQLIKP 210 Query: 184 T 186 T Sbjct: 211 T 211 >ref|XP_009367366.1| PREDICTED: B3 domain-containing protein At5g42700-like [Pyrus x bretschneideri] gi|694382753|ref|XP_009367367.1| PREDICTED: B3 domain-containing protein At5g42700-like [Pyrus x bretschneideri] Length = 236 Score = 78.2 bits (191), Expect = 6e-12 Identities = 34/61 (55%), Positives = 45/61 (73%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCK HLPK D +T++DE+GD++ T YLA+K GLSG W FA H L++GDA VF+ +P Sbjct: 155 FCKNHLPKGDEVMTLIDEDGDEYPTIYLARKTGLSGGWKGFAVAHDLVDGDALVFQLIRP 214 Query: 184 T 186 T Sbjct: 215 T 215 >ref|XP_008444633.1| PREDICTED: B3 domain-containing protein At5g42700-like [Cucumis melo] Length = 230 Score = 78.2 bits (191), Expect = 6e-12 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCK HLP +D +T++DE+GD++ T YLA+K GLSG W FA H+L +GDA +F+ KP Sbjct: 148 FCKIHLPNRDGVMTLIDEDGDEYPTIYLARKTGLSGGWKGFAVAHKLADGDAVIFQFIKP 207 Query: 184 T 186 T Sbjct: 208 T 208 >ref|XP_013620049.1| PREDICTED: B3 domain-containing protein At5g42700 [Brassica oleracea var. oleracea] Length = 227 Score = 77.4 bits (189), Expect = 1e-11 Identities = 33/62 (53%), Positives = 46/62 (74%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC++ L K+D +T++DEEG++FE YLAK+ GLSG W+ FA H L+ GDA VFE +P Sbjct: 149 FCRSELQKQDGVITLIDEEGEEFEIVYLAKRTGLSGGWLGFAVSHNLVYGDALVFELVRP 208 Query: 184 TL 189 T+ Sbjct: 209 TV 210 >ref|XP_011649586.1| PREDICTED: B3 domain-containing protein At3g19184-like [Cucumis sativus] gi|778671141|ref|XP_011649587.1| PREDICTED: B3 domain-containing protein At3g19184-like [Cucumis sativus] Length = 176 Score = 77.4 bits (189), Expect = 1e-11 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKTHLPK D +T++DE+GD++ YLA+K G SG W F+ H+L +GDA VF+ KP Sbjct: 95 FCKTHLPKNDGVMTLIDEDGDEYPIIYLARKTGFSGGWKGFSIAHKLSDGDAVVFQHIKP 154 Query: 184 T 186 T Sbjct: 155 T 155 >ref|XP_011458939.1| PREDICTED: B3 domain-containing protein At5g42700-like [Fragaria vesca subsp. vesca] Length = 228 Score = 77.4 bits (189), Expect = 1e-11 Identities = 35/62 (56%), Positives = 47/62 (75%) Frame = +1 Query: 1 RFCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTK 180 +FCK +L KKD +T++DEEG+++ET YLA+K GLSG W FA H L++GDA VF+ K Sbjct: 154 QFCKDYLSKKDEIMTLVDEEGNEYETIYLARKTGLSGGWKGFAVAHDLVDGDAVVFQLIK 213 Query: 181 PT 186 PT Sbjct: 214 PT 215 >gb|KGN62530.1| hypothetical protein Csa_2G359985 [Cucumis sativus] Length = 209 Score = 77.4 bits (189), Expect = 1e-11 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKTHLPK D +T++DE+GD++ YLA+K G SG W F+ H+L +GDA VF+ KP Sbjct: 138 FCKTHLPKNDGVMTLIDEDGDEYPIIYLARKTGFSGGWKGFSIAHKLSDGDAVVFQHIKP 197 Query: 184 T 186 T Sbjct: 198 T 198 >gb|KJB14568.1| hypothetical protein B456_002G131600 [Gossypium raimondii] Length = 140 Score = 77.0 bits (188), Expect = 1e-11 Identities = 35/61 (57%), Positives = 46/61 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKT+LPK+D +T++DEEG ++ T YLAKK GLSG W FA HRL++GDA VF+ + Sbjct: 65 FCKTNLPKRDEVMTLVDEEGHEYPTIYLAKKTGLSGGWKGFAVAHRLVDGDAIVFQLLQR 124 Query: 184 T 186 T Sbjct: 125 T 125 >gb|KJB14567.1| hypothetical protein B456_002G131600 [Gossypium raimondii] Length = 175 Score = 77.0 bits (188), Expect = 1e-11 Identities = 35/61 (57%), Positives = 46/61 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKT+LPK+D +T++DEEG ++ T YLAKK GLSG W FA HRL++GDA VF+ + Sbjct: 100 FCKTNLPKRDEVMTLVDEEGHEYPTIYLAKKTGLSGGWKGFAVAHRLVDGDAIVFQLLQR 159 Query: 184 T 186 T Sbjct: 160 T 160 >ref|XP_012466565.1| PREDICTED: B3 domain-containing protein At5g42700 [Gossypium raimondii] gi|763747127|gb|KJB14566.1| hypothetical protein B456_002G131600 [Gossypium raimondii] Length = 225 Score = 77.0 bits (188), Expect = 1e-11 Identities = 35/61 (57%), Positives = 46/61 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FCKT+LPK+D +T++DEEG ++ T YLAKK GLSG W FA HRL++GDA VF+ + Sbjct: 150 FCKTNLPKRDEVMTLVDEEGHEYPTIYLAKKTGLSGGWKGFAVAHRLVDGDAIVFQLLQR 209 Query: 184 T 186 T Sbjct: 210 T 210 >gb|EAY88816.1| hypothetical protein OsI_10288 [Oryza sativa Indica Group] Length = 237 Score = 77.0 bits (188), Expect = 1e-11 Identities = 36/61 (59%), Positives = 46/61 (75%) Frame = +1 Query: 4 FCKTHLPKKDAQVTVLDEEGDKFETTYLAKKVGLSGWWVTFAKYHRLINGDACVFERTKP 183 FC+T+LPK DA VT+LDE+ ++F+T YLA K GLSG W FA H L++GDA VF+ KP Sbjct: 158 FCETYLPKHDAIVTLLDEKDEQFDTNYLAYKNGLSGGWAGFALDHGLLDGDATVFQLVKP 217 Query: 184 T 186 T Sbjct: 218 T 218