BLASTX nr result
ID: Papaver29_contig00061751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00061751 (903 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011622197.1| PREDICTED: uncharacterized protein LOC105420... 55 1e-06 >ref|XP_011622197.1| PREDICTED: uncharacterized protein LOC105420407 [Amborella trichopoda] Length = 356 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = +3 Query: 768 GRRLVLIKHCLARLPIYFLSLCHLPASVEDTMKKLMRNFLWGST 899 G R+ L++ CLA P+Y +S H+PASV ++K+MR+FLWGST Sbjct: 223 GSRVTLLRSCLANPPVYQMSPIHMPASVAKRLEKMMRDFLWGST 266 Score = 25.8 bits (55), Expect(2) = 1e-06 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 701 VRDCVLERMEKNLASWKTKFL 763 V D VLER++ LA W+ K+L Sbjct: 200 VWDIVLERVQGRLALWRRKYL 220