BLASTX nr result
ID: Papaver29_contig00061568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00061568 (573 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM54070.1| hypothetical protein LR48_Vigan09g272900 [Vigna a... 58 3e-06 ref|XP_007148520.1| hypothetical protein PHAVU_006G215700g [Phas... 57 6e-06 >gb|KOM54070.1| hypothetical protein LR48_Vigan09g272900 [Vigna angularis] Length = 831 Score = 58.2 bits (139), Expect = 3e-06 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 14/75 (18%) Frame = -3 Query: 208 VLSVFLADVVFTVSTL-----HMVCRYMTK---------VPFETLGYLFTGSRHMNIGYY 71 VL+ FLA + T L ++ RY++ +P+E LGYLFTG R + + Y+ Sbjct: 128 VLTFFLAYIDRTTHLLVRDKKKIIVRYLSTWFVMDLASTIPYEALGYLFTGKRKVGLPYF 187 Query: 70 ILGLLRFWRLRNLKQ 26 +LGLLRFWR+R +KQ Sbjct: 188 LLGLLRFWRIRRVKQ 202 >ref|XP_007148520.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris] gi|561021743|gb|ESW20514.1| hypothetical protein PHAVU_006G215700g [Phaseolus vulgaris] Length = 832 Score = 57.0 bits (136), Expect = 6e-06 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 14/75 (18%) Frame = -3 Query: 208 VLSVFLADVVFTVSTL-----HMVCRYMTK---------VPFETLGYLFTGSRHMNIGYY 71 +L+ FLA + T L +V RY++ +P+E LGYLFTG + + Y+ Sbjct: 129 ILTFFLAYIDQTTHLLVRDKKKIVVRYLSTWFVMDLASTIPYEALGYLFTGKHKVGLPYF 188 Query: 70 ILGLLRFWRLRNLKQ 26 +LGLLRFWRLR +KQ Sbjct: 189 LLGLLRFWRLRRVKQ 203