BLASTX nr result
ID: Papaver29_contig00060986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00060986 (503 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB35451.1| hypothetical protein B456_006G115500, partial [Go... 65 3e-08 ref|XP_014490411.1| PREDICTED: transcription factor LHW-like [Vi... 64 4e-08 gb|KRH22636.1| hypothetical protein GLYMA_13G313000 [Glycine max] 64 4e-08 gb|KOM27558.1| hypothetical protein LR48_Vigan438s001400 [Vigna ... 64 4e-08 ref|XP_010089791.1| hypothetical protein L484_022306 [Morus nota... 64 4e-08 ref|XP_011088969.1| PREDICTED: transcription factor LHW [Sesamum... 64 4e-08 gb|KHN36498.1| Putative basic helix-loop-helix protein [Glycine ... 64 4e-08 ref|XP_010263009.1| PREDICTED: transcription factor LHW-like [Ne... 64 4e-08 ref|XP_010247165.1| PREDICTED: transcription factor LHW-like iso... 64 4e-08 ref|XP_010247158.1| PREDICTED: transcription factor LHW-like iso... 64 4e-08 ref|XP_010247149.1| PREDICTED: transcription factor LHW-like iso... 64 4e-08 ref|XP_009760053.1| PREDICTED: transcription factor LHW-like [Ni... 64 4e-08 ref|XP_009804416.1| PREDICTED: transcription factor LHW-like iso... 64 4e-08 ref|XP_009804415.1| PREDICTED: transcription factor LHW-like iso... 64 4e-08 ref|XP_009629479.1| PREDICTED: transcription factor LHW-like [Ni... 64 4e-08 ref|XP_009625580.1| PREDICTED: transcription factor LHW isoform ... 64 4e-08 ref|XP_009625579.1| PREDICTED: transcription factor LHW isoform ... 64 4e-08 ref|XP_013455740.1| bHLH transcription factor-like protein [Medi... 64 4e-08 ref|XP_013455739.1| bHLH transcription factor-like protein [Medi... 64 4e-08 ref|XP_008230230.1| PREDICTED: LOW QUALITY PROTEIN: transcriptio... 64 4e-08 >gb|KJB35451.1| hypothetical protein B456_006G115500, partial [Gossypium raimondii] Length = 836 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV*DYPFLFCNS 141 SIDALLE+TIKHMLFLQSVTKHA+ LKQTGESKV + CN+ Sbjct: 781 SIDALLEKTIKHMLFLQSVTKHADKLKQTGESKVWILFYYTCNA 824 >ref|XP_014490411.1| PREDICTED: transcription factor LHW-like [Vigna radiata var. radiata] Length = 957 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 779 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 812 >gb|KRH22636.1| hypothetical protein GLYMA_13G313000 [Glycine max] Length = 942 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 767 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 800 >gb|KOM27558.1| hypothetical protein LR48_Vigan438s001400 [Vigna angularis] Length = 914 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 779 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 812 >ref|XP_010089791.1| hypothetical protein L484_022306 [Morus notabilis] gi|587848119|gb|EXB38407.1| hypothetical protein L484_022306 [Morus notabilis] Length = 953 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 773 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 806 >ref|XP_011088969.1| PREDICTED: transcription factor LHW [Sesamum indicum] Length = 956 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 777 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 810 >gb|KHN36498.1| Putative basic helix-loop-helix protein [Glycine soja] Length = 965 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 790 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 823 >ref|XP_010263009.1| PREDICTED: transcription factor LHW-like [Nelumbo nucifera] Length = 943 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 764 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 797 >ref|XP_010247165.1| PREDICTED: transcription factor LHW-like isoform X3 [Nelumbo nucifera] Length = 900 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 721 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 754 >ref|XP_010247158.1| PREDICTED: transcription factor LHW-like isoform X2 [Nelumbo nucifera] Length = 930 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 793 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 826 >ref|XP_010247149.1| PREDICTED: transcription factor LHW-like isoform X1 [Nelumbo nucifera] Length = 972 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 793 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 826 >ref|XP_009760053.1| PREDICTED: transcription factor LHW-like [Nicotiana sylvestris] Length = 867 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 687 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 720 >ref|XP_009804416.1| PREDICTED: transcription factor LHW-like isoform X2 [Nicotiana sylvestris] Length = 948 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 772 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 805 >ref|XP_009804415.1| PREDICTED: transcription factor LHW-like isoform X1 [Nicotiana sylvestris] Length = 974 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 772 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 805 >ref|XP_009629479.1| PREDICTED: transcription factor LHW-like [Nicotiana tomentosiformis] Length = 876 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 696 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 729 >ref|XP_009625580.1| PREDICTED: transcription factor LHW isoform X2 [Nicotiana tomentosiformis] Length = 908 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 729 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 762 >ref|XP_009625579.1| PREDICTED: transcription factor LHW isoform X1 [Nicotiana tomentosiformis] Length = 944 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 765 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 798 >ref|XP_013455740.1| bHLH transcription factor-like protein [Medicago truncatula] gi|657387693|gb|KEH29771.1| bHLH transcription factor-like protein [Medicago truncatula] Length = 833 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 666 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 699 >ref|XP_013455739.1| bHLH transcription factor-like protein [Medicago truncatula] gi|657387692|gb|KEH29770.1| bHLH transcription factor-like protein [Medicago truncatula] Length = 921 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 754 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 787 >ref|XP_008230230.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor LHW [Prunus mume] Length = 963 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 10 SIDALLERTIKHMLFLQSVTKHANDLKQTGESKV 111 SIDALLERTIKHMLFLQSVTKHA+ LKQTGESK+ Sbjct: 784 SIDALLERTIKHMLFLQSVTKHADKLKQTGESKI 817