BLASTX nr result
ID: Papaver29_contig00058970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00058970 (855 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010276157.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 57 3e-06 gb|KMZ69173.1| Inositol-phosphate phosphatase [Zostera marina] 59 5e-06 >ref|XP_010276157.1| PREDICTED: phosphatase IMPL1, chloroplastic [Nelumbo nucifera] Length = 381 Score = 57.4 bits (137), Expect(2) = 3e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 411 DGTTNFAHGYPSFAVSVAVLFRGKPAA 331 DGTTNFAHGYPSFAVSV VLFRGKPAA Sbjct: 178 DGTTNFAHGYPSFAVSVGVLFRGKPAA 204 Score = 21.9 bits (45), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 494 IICSTDKMSGTAILG 450 ++ TDKMS AILG Sbjct: 130 LVTDTDKMSEAAILG 144 >gb|KMZ69173.1| Inositol-phosphate phosphatase [Zostera marina] Length = 363 Score = 58.9 bits (141), Expect = 5e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -1 Query: 411 DGTTNFAHGYPSFAVSVAVLFRGKPAAVVCMLPSEGLVQC 292 DGTTNFAHGYPSFAVSVAVLFRG+PAA C++ G C Sbjct: 160 DGTTNFAHGYPSFAVSVAVLFRGRPAA-ACVVEFVGGPMC 198