BLASTX nr result
ID: Papaver29_contig00058838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00058838 (1102 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011025311.1| PREDICTED: probable plastid-lipid-associated... 68 2e-08 ref|XP_013692254.1| PREDICTED: probable plastid-lipid-associated... 67 3e-08 ref|XP_013747583.1| PREDICTED: probable plastid-lipid-associated... 67 3e-08 ref|XP_013637625.1| PREDICTED: probable plastid-lipid-associated... 67 3e-08 ref|XP_009142583.1| PREDICTED: probable plastid-lipid-associated... 67 3e-08 emb|CDX80057.1| BnaA05g00990D [Brassica napus] 67 3e-08 emb|CDY41566.1| BnaC04g00560D [Brassica napus] 67 3e-08 ref|XP_006397881.1| hypothetical protein EUTSA_v10001577mg [Eutr... 67 3e-08 ref|XP_002301454.2| plastid-lipid associated protein PAP [Populu... 67 3e-08 ref|XP_014516214.1| PREDICTED: probable plastid-lipid-associated... 66 6e-08 ref|XP_014516211.1| PREDICTED: probable plastid-lipid-associated... 66 6e-08 ref|XP_002880273.1| plastid-lipid associated protein pap [Arabid... 66 6e-08 ref|NP_566091.1| putative plastid-lipid-associated protein 10 [A... 66 6e-08 gb|AAM62945.1| unknown [Arabidopsis thaliana] 66 6e-08 gb|KDO86699.1| hypothetical protein CISIN_1g023858mg [Citrus sin... 65 8e-08 gb|KDO86696.1| hypothetical protein CISIN_1g023858mg [Citrus sin... 65 8e-08 gb|KDO86695.1| hypothetical protein CISIN_1g023858mg [Citrus sin... 65 8e-08 ref|XP_006491427.1| PREDICTED: probable plastid-lipid-associated... 65 8e-08 ref|XP_006444668.1| hypothetical protein CICLE_v10021604mg [Citr... 65 8e-08 ref|XP_004507558.1| PREDICTED: probable plastid-lipid-associated... 65 1e-07 >ref|XP_011025311.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Populus euphratica] Length = 285 Score = 67.8 bits (164), Expect = 2e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRDQ+DGGV+ NVVQWSIP+LLEEQE Sbjct: 139 GQIFQKFECRDQSDGGVIRNVVQWSIPTLLEEQE 172 >ref|XP_013692254.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica napus] gi|923815406|ref|XP_013692255.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica napus] gi|923878467|ref|XP_013711909.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica napus] gi|923878470|ref|XP_013711910.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica napus] Length = 279 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 134 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 167 >ref|XP_013747583.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica napus] Length = 283 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 138 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 171 >ref|XP_013637625.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica oleracea var. oleracea] gi|922478978|ref|XP_013637627.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica oleracea var. oleracea] Length = 279 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 134 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 167 >ref|XP_009142583.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica rapa] gi|685303747|ref|XP_009142584.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Brassica rapa] Length = 283 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 138 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 171 >emb|CDX80057.1| BnaA05g00990D [Brassica napus] Length = 283 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 138 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 171 >emb|CDY41566.1| BnaC04g00560D [Brassica napus] Length = 896 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 751 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 784 >ref|XP_006397881.1| hypothetical protein EUTSA_v10001577mg [Eutrema salsugineum] gi|557098954|gb|ESQ39334.1| hypothetical protein EUTSA_v10001577mg [Eutrema salsugineum] Length = 283 Score = 66.6 bits (161), Expect = 3e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 138 GQIFQKFECRDRSDGGIIRNVVQWSVPSLLEEQE 171 >ref|XP_002301454.2| plastid-lipid associated protein PAP [Populus trichocarpa] gi|550345309|gb|EEE80727.2| plastid-lipid associated protein PAP [Populus trichocarpa] Length = 344 Score = 66.6 bits (161), Expect = 3e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQI+QKFECRDQ+DGGV+ NVVQWSIP+LLEEQE Sbjct: 198 GQIYQKFECRDQSDGGVIRNVVQWSIPTLLEEQE 231 >ref|XP_014516214.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic isoform X2 [Vigna radiata var. radiata] Length = 274 Score = 65.9 bits (159), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRDQ+DGG++ NVV+WSIP+LLEEQE Sbjct: 132 GQIFQKFECRDQSDGGIIRNVVRWSIPNLLEEQE 165 >ref|XP_014516211.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic isoform X1 [Vigna radiata var. radiata] gi|951035036|ref|XP_014516212.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic isoform X1 [Vigna radiata var. radiata] gi|951035039|ref|XP_014516213.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 296 Score = 65.9 bits (159), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRDQ+DGG++ NVV+WSIP+LLEEQE Sbjct: 154 GQIFQKFECRDQSDGGIIRNVVRWSIPNLLEEQE 187 >ref|XP_002880273.1| plastid-lipid associated protein pap [Arabidopsis lyrata subsp. lyrata] gi|297326112|gb|EFH56532.1| plastid-lipid associated protein pap [Arabidopsis lyrata subsp. lyrata] Length = 283 Score = 65.9 bits (159), Expect = 6e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQ+FQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 138 GQVFQKFECRDRSDGGIIRNVVQWSLPSLLEEQE 171 >ref|NP_566091.1| putative plastid-lipid-associated protein 10 [Arabidopsis thaliana] gi|75162466|sp|Q8W4F1.1|PAP10_ARATH RecName: Full=Probable plastid-lipid-associated protein 10, chloroplastic; AltName: Full=Fibrillin-8; Flags: Precursor gi|17065042|gb|AAL32675.1| Unknown protein [Arabidopsis thaliana] gi|20197139|gb|AAC34229.2| Expressed protein [Arabidopsis thaliana] gi|20259994|gb|AAM13344.1| unknown protein [Arabidopsis thaliana] gi|330255676|gb|AEC10770.1| putative plastid-lipid-associated protein 10 [Arabidopsis thaliana] Length = 284 Score = 65.9 bits (159), Expect = 6e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQ+FQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 139 GQVFQKFECRDRSDGGIIRNVVQWSLPSLLEEQE 172 >gb|AAM62945.1| unknown [Arabidopsis thaliana] Length = 284 Score = 65.9 bits (159), Expect = 6e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQ+FQKFECRD++DGG++ NVVQWS+PSLLEEQE Sbjct: 139 GQVFQKFECRDRSDGGIIRNVVQWSLPSLLEEQE 172 >gb|KDO86699.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] Length = 147 Score = 65.5 bits (158), Expect = 8e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGGV+CNVV+WS+P LLE++E Sbjct: 40 GQIFQKFECRDKSDGGVICNVVRWSVPPLLEKEE 73 >gb|KDO86696.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] gi|641868013|gb|KDO86697.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] gi|641868014|gb|KDO86698.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] Length = 185 Score = 65.5 bits (158), Expect = 8e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGGV+CNVV+WS+P LLE++E Sbjct: 40 GQIFQKFECRDKSDGGVICNVVRWSVPPLLEKEE 73 >gb|KDO86695.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] Length = 210 Score = 65.5 bits (158), Expect = 8e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGGV+CNVV+WS+P LLE++E Sbjct: 65 GQIFQKFECRDKSDGGVICNVVRWSVPPLLEKEE 98 >ref|XP_006491427.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic-like [Citrus sinensis] Length = 276 Score = 65.5 bits (158), Expect = 8e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGGV+CNVV+WS+P LLE++E Sbjct: 131 GQIFQKFECRDKSDGGVICNVVRWSVPPLLEKEE 164 >ref|XP_006444668.1| hypothetical protein CICLE_v10021604mg [Citrus clementina] gi|557546930|gb|ESR57908.1| hypothetical protein CICLE_v10021604mg [Citrus clementina] gi|641868009|gb|KDO86693.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] gi|641868010|gb|KDO86694.1| hypothetical protein CISIN_1g023858mg [Citrus sinensis] Length = 276 Score = 65.5 bits (158), Expect = 8e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECRD++DGGV+CNVV+WS+P LLE++E Sbjct: 131 GQIFQKFECRDKSDGGVICNVVRWSVPPLLEKEE 164 >ref|XP_004507558.1| PREDICTED: probable plastid-lipid-associated protein 10, chloroplastic [Cicer arietinum] Length = 277 Score = 64.7 bits (156), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 103 GQIFQKFECRDQTDGGVVCNVVQWSIPSLLEEQE 2 GQIFQKFECR TDGGV+ NVVQWSIP+LLEEQE Sbjct: 135 GQIFQKFECRGNTDGGVIRNVVQWSIPNLLEEQE 168