BLASTX nr result
ID: Papaver29_contig00058152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00058152 (460 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010921010.1| PREDICTED: gamma-interferon-inducible lysoso... 66 9e-09 ref|XP_008804105.1| PREDICTED: gamma-interferon-inducible lysoso... 65 1e-08 ref|XP_010922609.1| PREDICTED: gamma-interferon-inducible lysoso... 65 3e-08 ref|XP_008777702.1| PREDICTED: gamma-interferon-inducible lysoso... 64 3e-08 gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlise... 62 2e-07 ref|XP_010937930.1| PREDICTED: gamma-interferon-inducible lysoso... 62 2e-07 ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysoso... 62 2e-07 ref|XP_003567241.1| PREDICTED: gamma-interferon-inducible lysoso... 62 2e-07 ref|XP_012701629.1| PREDICTED: gamma-interferon-inducible lysoso... 60 5e-07 ref|XP_012701628.1| PREDICTED: gamma-interferon-inducible lysoso... 60 5e-07 ref|XP_012486254.1| PREDICTED: gamma-interferon-inducible lysoso... 60 5e-07 gb|KJB36937.1| hypothetical protein B456_006G184500 [Gossypium r... 60 5e-07 ref|XP_004970433.1| PREDICTED: gamma-interferon-inducible lysoso... 60 5e-07 ref|XP_002456575.1| hypothetical protein SORBIDRAFT_03g038650 [S... 60 5e-07 dbj|BAS75033.1| Os01g0828200 [Oryza sativa Japonica Group] 60 8e-07 ref|XP_006847417.1| PREDICTED: gamma-interferon-inducible lysoso... 60 8e-07 dbj|BAD73620.1| putative legumaturain [Oryza sativa Japonica Gro... 59 1e-06 ref|XP_009402396.1| PREDICTED: gamma-interferon-inducible lysoso... 59 1e-06 gb|EAY76352.1| hypothetical protein OsI_04287 [Oryza sativa Indi... 59 1e-06 gb|KMZ65435.1| Gamma-interferon-inducible lysosomal thiol reduct... 59 2e-06 >ref|XP_010921010.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Elaeis guineensis] Length = 244 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS F+++ L+KIFEN L DIVDL+LVPYGNA + NG I CQ Sbjct: 36 TLCPYCSNFIVNYLAKIFENGLIDIVDLDLVPYGNARVGSNGTISCQ 82 >ref|XP_008804105.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Phoenix dactylifera] Length = 254 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS F+++ L+KIFEN + DIVDL+LVPYGNA + NG I CQ Sbjct: 36 TLCPYCSNFIVNYLAKIFENGMIDIVDLDLVPYGNARVGSNGTISCQ 82 >ref|XP_010922609.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Elaeis guineensis] Length = 245 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS+F+ ++L KIF+N L IVDL+LVPYGNA L N IICQ Sbjct: 37 TLCPYCSDFITNNLVKIFDNGLISIVDLDLVPYGNARLGSNNSIICQ 83 >ref|XP_008777702.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Phoenix dactylifera] Length = 299 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 T+CP CS+F+ ++LSKIF+N L IVDL+LVPYGNA + N I+CQ Sbjct: 90 TMCPYCSDFITNNLSKIFDNGLISIVDLDLVPYGNAGVGSNNSIMCQ 136 >gb|EPS59926.1| hypothetical protein M569_14879, partial [Genlisea aurea] Length = 200 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP C++F+++ LSKIF+NRL D+VDL L+P+GN +L N CQ Sbjct: 17 SLCPYCADFIVNKLSKIFQNRLIDVVDLRLIPWGNTHILPNSTWACQ 63 >ref|XP_010937930.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X2 [Elaeis guineensis] Length = 223 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS F+++ L+KIFEN L DI++L+L+PYGNA + N I CQ Sbjct: 36 TLCPYCSNFIVNYLAKIFENGLIDIIELDLIPYGNARIGSNDTISCQ 82 >ref|XP_010937929.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase isoform X1 [Elaeis guineensis] Length = 254 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS F+++ L+KIFEN L DI++L+L+PYGNA + N I CQ Sbjct: 36 TLCPYCSNFIVNYLAKIFENGLIDIIELDLIPYGNARIGSNDTISCQ 82 >ref|XP_003567241.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Brachypodium distachyon] gi|944074913|gb|KQK10397.1| hypothetical protein BRADI_2g53861 [Brachypodium distachyon] Length = 243 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF+N LS IVDL LVP+GN + +G + CQ Sbjct: 39 TLCPFCSGFVVNDLARIFQNGLSSIVDLRLVPFGNGRVSPDGSMTCQ 85 >ref|XP_012701629.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X3 [Setaria italica] Length = 186 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS FV++DL++IF N +S I DL LVP+GN + +G I CQ Sbjct: 29 VTVSVYYETLCPFCSAFVVNDLARIFNNGVSSIADLRLVPFGNGRVSADGSITCQ 83 >ref|XP_012701628.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X2 [Setaria italica] gi|944243237|gb|KQL07545.1| hypothetical protein SETIT_004499mg [Setaria italica] Length = 231 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS FV++DL++IF N +S I DL LVP+GN + +G I CQ Sbjct: 29 VTVSVYYETLCPFCSAFVVNDLARIFNNGVSSIADLRLVPFGNGRVSADGSITCQ 83 >ref|XP_012486254.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Gossypium raimondii] gi|763769723|gb|KJB36938.1| hypothetical protein B456_006G184500 [Gossypium raimondii] Length = 242 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS+F+++ L K+F +RL IV+L LVP+GNA L NG +CQ Sbjct: 26 VTLSVYYETLCPYCSDFIVNHLVKLFHSRLFSIVNLRLVPWGNAVLQSNGSFLCQ 80 >gb|KJB36937.1| hypothetical protein B456_006G184500 [Gossypium raimondii] Length = 224 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS+F+++ L K+F +RL IV+L LVP+GNA L NG +CQ Sbjct: 26 VTLSVYYETLCPYCSDFIVNHLVKLFHSRLFSIVNLRLVPWGNAVLQSNGSFLCQ 80 >ref|XP_004970433.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like isoform X1 [Setaria italica] Length = 242 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS FV++DL++IF N +S I DL LVP+GN + +G I CQ Sbjct: 29 VTVSVYYETLCPFCSAFVVNDLARIFNNGVSSIADLRLVPFGNGRVSADGSITCQ 83 >ref|XP_002456575.1| hypothetical protein SORBIDRAFT_03g038650 [Sorghum bicolor] gi|241928550|gb|EES01695.1| hypothetical protein SORBIDRAFT_03g038650 [Sorghum bicolor] Length = 232 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DLS++F N +S I DL LVP+GN + +G I CQ Sbjct: 38 TLCPFCSAFVVNDLSRVFRNGISSIADLRLVPFGNGRVSADGTITCQ 84 >dbj|BAS75033.1| Os01g0828200 [Oryza sativa Japonica Group] Length = 242 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = +3 Query: 123 ITTYTPIRTLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +T TLCP CS FV++DL++IF + LS +VDL LVP+GN + +G I CQ Sbjct: 36 VTMSVYYETLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQ 90 >ref|XP_006847417.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase [Amborella trichopoda] gi|548850583|gb|ERN08998.1| hypothetical protein AMTR_s00153p00064140 [Amborella trichopoda] Length = 241 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++ L K+F N L DIVDL L+PYGNA + N I CQ Sbjct: 36 TLCPYCSRFVVNYLGKMFSNGLIDIVDLRLIPYGNAWIGSNNTISCQ 82 >dbj|BAD73620.1| putative legumaturain [Oryza sativa Japonica Group] gi|125572499|gb|EAZ14014.1| hypothetical protein OsJ_03939 [Oryza sativa Japonica Group] Length = 246 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF + LS +VDL LVP+GN + +G I CQ Sbjct: 7 TLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQ 53 >ref|XP_009402396.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Musa acuminata subsp. malaccensis] Length = 255 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS F+++ LSKIF + L IVDL+L+PYGNA L N + CQ Sbjct: 47 TLCPYCSNFIVNHLSKIFHDGLISIVDLDLIPYGNARLGSNSTMSCQ 93 >gb|EAY76352.1| hypothetical protein OsI_04287 [Oryza sativa Indica Group] Length = 246 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 TLCP CS FV++DL++IF + LS +VDL LVP+GN + +G I CQ Sbjct: 7 TLCPFCSGFVVNDLARIFRDGLSPVVDLRLVPFGNGRVSPDGSITCQ 53 >gb|KMZ65435.1| Gamma-interferon-inducible lysosomal thiol reductase [Zostera marina] Length = 239 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 147 TLCPACSEFVLHDLSKIFENRLSDIVDLNLVPYGNADLLKNGKIICQ 287 +LCP + F+++ L KIF N L IVDL L PYGNA +L +G+IICQ Sbjct: 37 SLCPYSARFIVNQLDKIFSNGLISIVDLQLFPYGNAKVLSDGEIICQ 83