BLASTX nr result
ID: Papaver29_contig00058117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00058117 (436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013448621.1| F-box protein interaction domain protein [Me... 58 2e-06 ref|XP_013448641.1| F-box protein interaction domain protein [Me... 57 7e-06 ref|XP_013441861.1| F-box protein interaction domain protein [Me... 56 9e-06 >ref|XP_013448621.1| F-box protein interaction domain protein [Medicago truncatula] gi|657377804|gb|KEH22648.1| F-box protein interaction domain protein [Medicago truncatula] Length = 422 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/57 (47%), Positives = 36/57 (63%) Frame = +1 Query: 166 IVIDILSKLPVKSLMQFKSVCKHWLSLIKHDTQLIDLHCTLSKSRLNLLCIAPLPPE 336 ++ DILS+LPVK+LMQFK VCK W +LI HD LH S+ +L ++ L E Sbjct: 26 LITDILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSQRNTHLALVSDLSSE 82 >ref|XP_013448641.1| F-box protein interaction domain protein [Medicago truncatula] gi|657377824|gb|KEH22668.1| F-box protein interaction domain protein [Medicago truncatula] Length = 418 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/52 (48%), Positives = 34/52 (65%) Frame = +1 Query: 166 IVIDILSKLPVKSLMQFKSVCKHWLSLIKHDTQLIDLHCTLSKSRLNLLCIA 321 +++DILS+LPVK+LMQFK VCK W +LI HD LH S +L ++ Sbjct: 22 LIVDILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSPRNTHLTLVS 73 >ref|XP_013441861.1| F-box protein interaction domain protein [Medicago truncatula] gi|657369443|gb|KEH15886.1| F-box protein interaction domain protein [Medicago truncatula] Length = 430 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/64 (45%), Positives = 38/64 (59%) Frame = +1 Query: 121 NATPVGSFPCYVDEGIVIDILSKLPVKSLMQFKSVCKHWLSLIKHDTQLIDLHCTLSKSR 300 N S +DE ++++ILS+LPVK+LMQFK VCK W +LI HD LH S Sbjct: 13 NCCATTSLIVLLDE-LIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSPRN 71 Query: 301 LNLL 312 +LL Sbjct: 72 THLL 75