BLASTX nr result
ID: Papaver29_contig00057914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00057914 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADY68770.1| DREB1/CBF transcription factor [Adonis amurensis] 57 4e-06 >gb|ADY68770.1| DREB1/CBF transcription factor [Adonis amurensis] Length = 206 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 12/65 (18%) Frame = -1 Query: 422 SNSSSSP----------AMFYDDEALYYMPSLIASMAEGMLLQPP--QESYYFGDVDCNV 279 S+SSSSP +MF+D+EA++ MPSL+ +MAEGMLL PP QE + DVD N+ Sbjct: 140 SSSSSSPMNLRVPVEPSSMFWDEEAMFNMPSLLDNMAEGMLLTPPSMQERFSCEDVDFNM 199 Query: 278 NSSIW 264 S+W Sbjct: 200 ELSLW 204