BLASTX nr result
ID: Papaver29_contig00057911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00057911 (615 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009546299.1| hypothetical protein HETIRDRAFT_427006 [Hete... 51 6e-06 >ref|XP_009546299.1| hypothetical protein HETIRDRAFT_427006 [Heterobasidion irregulare TC 32-1] gi|575066059|gb|ETW81673.1| hypothetical protein HETIRDRAFT_427006 [Heterobasidion irregulare TC 32-1] Length = 1002 Score = 50.8 bits (120), Expect(2) = 6e-06 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 249 LRSPVFSHGQLYVALSRCTSAGRIHVLLPKNSSRHK 142 L PVFSHGQLYVALSRCTS RI VL P +S K Sbjct: 950 LERPVFSHGQLYVALSRCTSGDRIKVLFPPDSQGTK 985 Score = 26.2 bits (56), Expect(2) = 6e-06 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 166 PKEQF*TQTTNVVYPEIL 113 P + T+TTN+VYPE+L Sbjct: 978 PPDSQGTKTTNIVYPEVL 995