BLASTX nr result
ID: Papaver29_contig00057904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00057904 (490 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012090516.1| PREDICTED: CMP-sialic acid transporter 5 [Ja... 63 8e-08 ref|XP_002268717.2| PREDICTED: CMP-sialic acid transporter 5 [Vi... 61 3e-07 ref|XP_002531256.1| UDP-N-acetylglucosamine transporter, putativ... 61 3e-07 gb|KHN06582.1| CMP-sialic acid transporter 5 [Glycine soja] 61 4e-07 ref|XP_008233981.1| PREDICTED: CMP-sialic acid transporter 5 [Pr... 61 4e-07 ref|XP_007159655.1| hypothetical protein PHAVU_002G256000g [Phas... 61 4e-07 ref|XP_007205535.1| hypothetical protein PRUPE_ppa008544mg [Prun... 61 4e-07 emb|CDP01453.1| unnamed protein product [Coffea canephora] 60 5e-07 gb|KDO56574.1| hypothetical protein CISIN_1g016767mg [Citrus sin... 60 5e-07 gb|KDO36447.1| hypothetical protein CISIN_1g029315mg [Citrus sin... 60 5e-07 ref|XP_006464232.1| PREDICTED: CMP-sialic acid transporter 5-lik... 60 5e-07 ref|XP_006428191.1| hypothetical protein CICLE_v10025805mg [Citr... 60 5e-07 ref|XP_010087590.1| CMP-sialic acid transporter 5 [Morus notabil... 60 6e-07 ref|XP_012489286.1| PREDICTED: CMP-sialic acid transporter 5-lik... 60 6e-07 gb|KHG08794.1| hypothetical protein F383_15436 [Gossypium arboreum] 60 6e-07 ref|XP_007047955.1| Nucleotide-sugar transporter family protein ... 60 6e-07 ref|XP_014505819.1| PREDICTED: CMP-sialic acid transporter 5 [Vi... 60 8e-07 ref|XP_010680551.1| PREDICTED: CMP-sialic acid transporter 5 [Be... 60 8e-07 ref|XP_010268000.1| PREDICTED: CMP-sialic acid transporter 5 [Ne... 60 8e-07 ref|XP_009343556.1| PREDICTED: CMP-sialic acid transporter 5-lik... 60 8e-07 >ref|XP_012090516.1| PREDICTED: CMP-sialic acid transporter 5 [Jatropha curcas] gi|643741359|gb|KDP46835.1| hypothetical protein JCGZ_24044 [Jatropha curcas] Length = 330 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIF+GKPPSIYCLLALPLVISSISI Sbjct: 286 LVTALLQFIFEGKPPSIYCLLALPLVISSISI 317 >ref|XP_002268717.2| PREDICTED: CMP-sialic acid transporter 5 [Vitis vinifera] gi|296084745|emb|CBI25889.3| unnamed protein product [Vitis vinifera] Length = 327 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIFDGKPPS YC+LALPLVI+SISI Sbjct: 283 LVTALLQFIFDGKPPSFYCILALPLVITSISI 314 >ref|XP_002531256.1| UDP-N-acetylglucosamine transporter, putative [Ricinus communis] gi|223529141|gb|EEF31120.1| UDP-N-acetylglucosamine transporter, putative [Ricinus communis] Length = 326 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQFIF+GKPPS+YCLLALPLVISSISI Sbjct: 282 LVTAMLQFIFEGKPPSMYCLLALPLVISSISI 313 >gb|KHN06582.1| CMP-sialic acid transporter 5 [Glycine soja] Length = 313 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 L+TALLQFIFDGKPPS+YCL+ALPLV++SISI Sbjct: 269 LITALLQFIFDGKPPSLYCLVALPLVVTSISI 300 >ref|XP_008233981.1| PREDICTED: CMP-sialic acid transporter 5 [Prunus mume] Length = 327 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIF+GKPPS+YCL+ALPLV+SSISI Sbjct: 283 LVTALLQFIFEGKPPSLYCLVALPLVVSSISI 314 >ref|XP_007159655.1| hypothetical protein PHAVU_002G256000g [Phaseolus vulgaris] gi|561033070|gb|ESW31649.1| hypothetical protein PHAVU_002G256000g [Phaseolus vulgaris] Length = 329 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 L+TALLQFIFDGKPPS+YCL+ALPLV++SISI Sbjct: 285 LITALLQFIFDGKPPSLYCLVALPLVVTSISI 316 >ref|XP_007205535.1| hypothetical protein PRUPE_ppa008544mg [Prunus persica] gi|462401177|gb|EMJ06734.1| hypothetical protein PRUPE_ppa008544mg [Prunus persica] Length = 327 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIF+GKPPS+YCL+ALPLV+SSISI Sbjct: 283 LVTALLQFIFEGKPPSLYCLVALPLVVSSISI 314 >emb|CDP01453.1| unnamed protein product [Coffea canephora] Length = 77 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQF+FDGKPPS+YCL+ALPLVI+S+S+ Sbjct: 33 LVTALLQFVFDGKPPSLYCLVALPLVITSVSV 64 >gb|KDO56574.1| hypothetical protein CISIN_1g016767mg [Citrus sinensis] Length = 383 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQFIF+GKPPS+YCL+ALPLV+SSISI Sbjct: 339 LVTAMLQFIFEGKPPSLYCLIALPLVVSSISI 370 >gb|KDO36447.1| hypothetical protein CISIN_1g029315mg [Citrus sinensis] Length = 195 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQFIF+GKPPS+YCL+ALPLV+SSISI Sbjct: 151 LVTAMLQFIFEGKPPSLYCLIALPLVVSSISI 182 >ref|XP_006464232.1| PREDICTED: CMP-sialic acid transporter 5-like isoform X1 [Citrus sinensis] Length = 331 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQFIF+GKPPS+YCL+ALPLV+SSISI Sbjct: 287 LVTAMLQFIFEGKPPSLYCLIALPLVVSSISI 318 >ref|XP_006428191.1| hypothetical protein CICLE_v10025805mg [Citrus clementina] gi|557530181|gb|ESR41431.1| hypothetical protein CICLE_v10025805mg [Citrus clementina] Length = 391 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQFIF+GKPPS+YCL+ALPLV+SSISI Sbjct: 347 LVTAMLQFIFEGKPPSLYCLIALPLVVSSISI 378 >ref|XP_010087590.1| CMP-sialic acid transporter 5 [Morus notabilis] gi|587838756|gb|EXB29445.1| CMP-sialic acid transporter 5 [Morus notabilis] Length = 324 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIF+GKPPS+YCL+ALP+V+SSISI Sbjct: 280 LVTALLQFIFEGKPPSLYCLVALPIVVSSISI 311 >ref|XP_012489286.1| PREDICTED: CMP-sialic acid transporter 5-like [Gossypium raimondii] gi|763773251|gb|KJB40374.1| hypothetical protein B456_007G060800 [Gossypium raimondii] Length = 327 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQF+F+GKPPS+YCL+ALPLVISSISI Sbjct: 283 LVTAMLQFLFEGKPPSVYCLVALPLVISSISI 314 >gb|KHG08794.1| hypothetical protein F383_15436 [Gossypium arboreum] Length = 327 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQF+F+GKPPS+YCL+ALPLVISSISI Sbjct: 283 LVTAMLQFLFEGKPPSVYCLVALPLVISSISI 314 >ref|XP_007047955.1| Nucleotide-sugar transporter family protein [Theobroma cacao] gi|508700216|gb|EOX92112.1| Nucleotide-sugar transporter family protein [Theobroma cacao] Length = 312 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQF+F+GKPPS+YCL+ALPLVISSISI Sbjct: 268 LVTAMLQFLFEGKPPSVYCLVALPLVISSISI 299 >ref|XP_014505819.1| PREDICTED: CMP-sialic acid transporter 5 [Vigna radiata var. radiata] Length = 329 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 L+TALLQF+FDGKPPS+YCL+ALP+V++SISI Sbjct: 285 LITALLQFVFDGKPPSLYCLVALPIVVTSISI 316 >ref|XP_010680551.1| PREDICTED: CMP-sialic acid transporter 5 [Beta vulgaris subsp. vulgaris] gi|870857229|gb|KMT08789.1| hypothetical protein BVRB_6g135130 [Beta vulgaris subsp. vulgaris] Length = 334 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIFDGKPPS YCL+ALPLVI+SISI Sbjct: 290 LVTALLQFIFDGKPPSPYCLVALPLVITSISI 321 >ref|XP_010268000.1| PREDICTED: CMP-sialic acid transporter 5 [Nelumbo nucifera] Length = 327 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTALLQFIFDGKPPS YCLLALPLV+SSI I Sbjct: 283 LVTALLQFIFDGKPPSSYCLLALPLVVSSIFI 314 >ref|XP_009343556.1| PREDICTED: CMP-sialic acid transporter 5-like [Pyrus x bretschneideri] Length = 328 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 490 LVTALLQFIFDGKPPSIYCLLALPLVISSISI 395 LVTA+LQFIF+GKPPS+YCLLALPLV SSISI Sbjct: 284 LVTAMLQFIFEGKPPSLYCLLALPLVASSISI 315