BLASTX nr result
ID: Papaver29_contig00057100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00057100 (569 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB21839.1| hypothetical protein B456_004G017300 [Gossypium r... 62 1e-07 ref|XP_014495744.1| PREDICTED: serine/threonine-protein phosphat... 57 6e-06 gb|KRH58905.1| hypothetical protein GLYMA_05G155300 [Glycine max] 57 6e-06 gb|KRH42815.1| hypothetical protein GLYMA_08G113200 [Glycine max] 57 6e-06 gb|KQK92409.1| hypothetical protein SETIT_036078mg [Setaria ital... 57 6e-06 gb|ALA55545.1| Protein Phosphatase 2A Catalytic Subunit [Lilium ... 57 6e-06 ref|XP_013591939.1| PREDICTED: serine/threonine-protein phosphat... 57 6e-06 ref|XP_013591938.1| PREDICTED: serine/threonine-protein phosphat... 57 6e-06 ref|XP_013629085.1| PREDICTED: serine/threonine-protein phosphat... 57 6e-06 gb|KOM39531.1| hypothetical protein LR48_Vigan03g291300 [Vigna a... 57 6e-06 ref|XP_014513860.1| PREDICTED: serine/threonine-protein phosphat... 57 6e-06 ref|XP_014508937.1| PREDICTED: serine/threonine-protein phosphat... 57 6e-06 gb|KNE66895.1| serine/threonine-protein phosphatase PP2A catalyt... 57 6e-06 gb|KNE60395.1| serine/threonine-protein phosphatase PP2A catalyt... 57 6e-06 gb|KNA24326.1| hypothetical protein SOVF_016820 [Spinacia oleracea] 57 6e-06 gb|KNA08612.1| hypothetical protein SOVF_161060 isoform A, parti... 57 6e-06 gb|KMZ76533.1| Serine/threonine-protein phosphatase [Zostera mar... 57 6e-06 gb|KMZ59146.1| Serine/threonine-protein phosphatase PP2A catalyt... 57 6e-06 ref|XP_961818.2| serine/threonine-protein phosphatase PP2A catal... 57 6e-06 dbj|BAA92336.1| type 2A protein phosphatase-III [Vicia faba] 57 6e-06 >gb|KJB21839.1| hypothetical protein B456_004G017300 [Gossypium raimondii] Length = 261 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -2 Query: 109 LIYVFFLSLLV*CPDTNYLFMGDYVDRGYYSVETVT 2 LI+ F L V CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 15 LIFSFCCKLSVQCPDTNYLFMGDYVDRGYYSVETVT 50 >ref|XP_014495744.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Vigna radiata var. radiata] Length = 313 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >gb|KRH58905.1| hypothetical protein GLYMA_05G155300 [Glycine max] Length = 253 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 77 CPDTNYLFMGDYVDRGYYSVETVT 100 >gb|KRH42815.1| hypothetical protein GLYMA_08G113200 [Glycine max] Length = 256 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 77 CPDTNYLFMGDYVDRGYYSVETVT 100 >gb|KQK92409.1| hypothetical protein SETIT_036078mg [Setaria italica] Length = 390 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 156 CPDTNYLFMGDYVDRGYYSVETVT 179 >gb|ALA55545.1| Protein Phosphatase 2A Catalytic Subunit [Lilium hybrid division VII] Length = 310 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 76 CPDTNYLFMGDYVDRGYYSVETVT 99 >ref|XP_013591939.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X2 [Brassica oleracea var. oleracea] Length = 166 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >ref|XP_013591938.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like isoform X1 [Brassica oleracea var. oleracea] Length = 310 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >ref|XP_013629085.1| PREDICTED: serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Brassica oleracea var. oleracea] Length = 313 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >gb|KOM39531.1| hypothetical protein LR48_Vigan03g291300 [Vigna angularis] Length = 266 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >ref|XP_014513860.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like [Vigna radiata var. radiata] gi|920690847|gb|KOM34072.1| hypothetical protein LR48_Vigan02g022200 [Vigna angularis] Length = 314 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 80 CPDTNYLFMGDYVDRGYYSVETVT 103 >ref|XP_014508937.1| PREDICTED: serine/threonine-protein phosphatase PP2A catalytic subunit [Vigna radiata var. radiata] gi|920686984|gb|KOM30967.1| hypothetical protein LR48_Vigan01g052200 [Vigna angularis] Length = 311 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 77 CPDTNYLFMGDYVDRGYYSVETVT 100 >gb|KNE66895.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Allomyces macrogynus ATCC 38327] gi|909145192|gb|KNE68958.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Allomyces macrogynus ATCC 38327] Length = 308 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 74 CPDTNYLFMGDYVDRGYYSVETVT 97 >gb|KNE60395.1| serine/threonine-protein phosphatase PP2A catalytic subunit [Allomyces macrogynus ATCC 38327] Length = 175 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 74 CPDTNYLFMGDYVDRGYYSVETVT 97 >gb|KNA24326.1| hypothetical protein SOVF_016820 [Spinacia oleracea] Length = 313 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 79 CPDTNYLFMGDYVDRGYYSVETVT 102 >gb|KNA08612.1| hypothetical protein SOVF_161060 isoform A, partial [Spinacia oleracea] Length = 105 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 72 CPDTNYLFMGDYVDRGYYSVETVT 95 >gb|KMZ76533.1| Serine/threonine-protein phosphatase [Zostera marina] Length = 317 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 83 CPDTNYLFMGDYVDRGYYSVETVT 106 >gb|KMZ59146.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Zostera marina] Length = 320 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 86 CPDTNYLFMGDYVDRGYYSVETVT 109 >ref|XP_961818.2| serine/threonine-protein phosphatase PP2A catalytic subunit [Neurospora crassa OR74A] gi|698984576|ref|XP_009849269.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Neurospora tetrasperma FGSC 2508] gi|29611957|sp|P48580.3|PP2A1_NEUCR RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic subunit gi|157070762|gb|EAA32582.2| serine/threonine-protein phosphatase PP2A catalytic subunit [Neurospora crassa OR74A] gi|336470819|gb|EGO58980.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Neurospora tetrasperma FGSC 2508] gi|350291885|gb|EGZ73080.1| Serine/threonine-protein phosphatase PP2A catalytic subunit [Neurospora tetrasperma FGSC 2509] gi|725980835|gb|KHE83989.1| hypothetical protein GE21DRAFT_5649 [Neurospora crassa] Length = 327 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 93 CPDTNYLFMGDYVDRGYYSVETVT 116 >dbj|BAA92336.1| type 2A protein phosphatase-III [Vicia faba] Length = 71 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 73 CPDTNYLFMGDYVDRGYYSVETVT 2 CPDTNYLFMGDYVDRGYYSVETVT Sbjct: 14 CPDTNYLFMGDYVDRGYYSVETVT 37