BLASTX nr result
ID: Papaver29_contig00056607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00056607 (440 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_191031.1| CDT1-like protein b [Arabidopsis thaliana] gi|7... 65 2e-08 ref|XP_011026004.1| PREDICTED: CDT1-like protein a, chloroplasti... 65 2e-08 ref|XP_010037986.1| PREDICTED: CDT1-like protein a, chloroplasti... 64 3e-08 ref|XP_002307639.2| hypothetical protein POPTR_0005s24410g [Popu... 64 4e-08 ref|XP_011028782.1| PREDICTED: CDT1-like protein a, chloroplasti... 64 6e-08 ref|XP_010555868.1| PREDICTED: CDT1-like protein b [Tarenaya has... 64 6e-08 ref|XP_010918795.1| PREDICTED: CDT1-like protein a, chloroplasti... 63 1e-07 ref|XP_002300782.2| hypothetical protein POPTR_0002s04120g [Popu... 62 1e-07 ref|XP_012085335.1| PREDICTED: CDT1-like protein a, chloroplasti... 62 2e-07 ref|XP_002876266.1| hypothetical protein ARALYDRAFT_485876 [Arab... 62 2e-07 ref|XP_002263743.2| PREDICTED: CDT1-like protein a, chloroplasti... 62 2e-07 ref|XP_008787296.1| PREDICTED: CDT1-like protein a, chloroplasti... 62 2e-07 emb|CBI37094.3| unnamed protein product [Vitis vinifera] 62 2e-07 ref|XP_008806924.1| PREDICTED: CDT1-like protein a, chloroplasti... 61 3e-07 emb|CDP03731.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_013631951.1| PREDICTED: LOW QUALITY PROTEIN: CDT1-like pr... 60 5e-07 ref|XP_010904590.1| PREDICTED: CDT1-like protein a, chloroplasti... 60 5e-07 ref|XP_013742448.1| PREDICTED: CDT1-like protein b [Brassica nap... 60 5e-07 ref|XP_002532371.1| conserved hypothetical protein [Ricinus comm... 60 5e-07 ref|XP_009803239.1| PREDICTED: CDT1-like protein a, chloroplasti... 60 6e-07 >ref|NP_191031.1| CDT1-like protein b [Arabidopsis thaliana] gi|75182149|sp|Q9M1S9.1|CDT1B_ARATH RecName: Full=CDT1-like protein b; Short=AtCDT1b gi|7258375|emb|CAB77591.1| putative protein [Arabidopsis thaliana] gi|38567370|emb|CAD13173.1| CDT1b protein [Arabidopsis thaliana] gi|115646793|gb|ABJ17120.1| At3g54710 [Arabidopsis thaliana] gi|332645748|gb|AEE79269.1| CDT1-like protein b [Arabidopsis thaliana] Length = 486 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 ITDR+E+E QL+L+ +L+P+WISE ASSGD L+RINKM + + +R RL +A Sbjct: 426 ITDRREVEEQLSLMLQLVPDWISETKASSGDLLVRINKMSTAETVRARLEEA 477 >ref|XP_011026004.1| PREDICTED: CDT1-like protein a, chloroplastic [Populus euphratica] Length = 564 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E++ QL LL EL+P WISE +ASSGD+L RINKM S + +R RL +A Sbjct: 512 IADRREVDEQLNLLLELVPEWISEKLASSGDSLFRINKMYSPETIRARLEEA 563 >ref|XP_010037986.1| PREDICTED: CDT1-like protein a, chloroplastic [Eucalyptus grandis] gi|629083333|gb|KCW49778.1| hypothetical protein EUGRSUZ_K03269 [Eucalyptus grandis] Length = 611 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -2 Query: 436 FYITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 F + DR+E+E QL L+KEL+P WISE AS+GD L +NKM D +R++LA+A Sbjct: 557 FDMIDRREVEEQLDLMKELVPEWISEKAASTGDRLFSVNKMSDPDSIRQQLAEA 610 >ref|XP_002307639.2| hypothetical protein POPTR_0005s24410g [Populus trichocarpa] gi|550339663|gb|EEE94635.2| hypothetical protein POPTR_0005s24410g [Populus trichocarpa] Length = 444 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E++ QL LL EL+P WISE +ASSGD++ RINKM S + +R RL +A Sbjct: 392 IADRREVDEQLNLLLELVPEWISEKLASSGDSIFRINKMYSPETVRARLEEA 443 >ref|XP_011028782.1| PREDICTED: CDT1-like protein a, chloroplastic [Populus euphratica] Length = 563 Score = 63.5 bits (153), Expect = 6e-08 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = -2 Query: 436 FYITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 F I DR+E+E QL LL EL+P WISE +ASSGD L RINK+ S + +R +L +A Sbjct: 509 FDIADRREVEEQLNLLLELVPEWISEKLASSGDLLFRINKLYSPETVRAQLEEA 562 >ref|XP_010555868.1| PREDICTED: CDT1-like protein b [Tarenaya hassleriana] Length = 542 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = -2 Query: 427 TDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 TD+KE+E QL+++ EL+P WISE ASSGD L+RINKM + +R RL +A Sbjct: 483 TDKKEVEEQLSVMLELVPEWISETKASSGDLLVRINKMSEAEVIRARLGEA 533 >ref|XP_010918795.1| PREDICTED: CDT1-like protein a, chloroplastic [Elaeis guineensis] Length = 590 Score = 62.8 bits (151), Expect = 1e-07 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR E+E QL LL EL+P+WISE ASSGD L +NK+ S +E+R+RLA+A Sbjct: 538 IVDRGEVEEQLELLLELVPDWISEKKASSGDILCCVNKITSPEEIRQRLAEA 589 >ref|XP_002300782.2| hypothetical protein POPTR_0002s04120g [Populus trichocarpa] gi|550344243|gb|EEE80055.2| hypothetical protein POPTR_0002s04120g [Populus trichocarpa] Length = 496 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E+E QL LL EL+P WISE +ASSGD L RINK+ S + +R +L +A Sbjct: 444 IADRREVEEQLNLLLELVPEWISEKLASSGDLLFRINKLYSPETVRAQLEEA 495 >ref|XP_012085335.1| PREDICTED: CDT1-like protein a, chloroplastic [Jatropha curcas] gi|643713886|gb|KDP26551.1| hypothetical protein JCGZ_17709 [Jatropha curcas] Length = 610 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E+E QL LL EL+P WISE ASSGD L INKM S + +R RL +A Sbjct: 558 IVDRREVEEQLKLLLELVPEWISEKSASSGDLLFCINKMSSAENIRSRLEEA 609 >ref|XP_002876266.1| hypothetical protein ARALYDRAFT_485876 [Arabidopsis lyrata subsp. lyrata] gi|297322104|gb|EFH52525.1| hypothetical protein ARALYDRAFT_485876 [Arabidopsis lyrata subsp. lyrata] Length = 475 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/52 (53%), Positives = 41/52 (78%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 ITDR+E+E QL+L+ +L+P+WISE ASSGD L+ INKM + + +R +L +A Sbjct: 415 ITDRREVEEQLSLMLQLVPDWISETKASSGDLLVSINKMSAAETVRAKLEEA 466 >ref|XP_002263743.2| PREDICTED: CDT1-like protein a, chloroplastic [Vitis vinifera] Length = 577 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E+E QL LL+EL+P WISE +ASSGD LL I K S + +R+RL +A Sbjct: 525 IVDRREVEEQLKLLQELVPEWISEKLASSGDLLLCIKKTSSPESIRQRLMEA 576 >ref|XP_008787296.1| PREDICTED: CDT1-like protein a, chloroplastic [Phoenix dactylifera] Length = 589 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR E+E QL LL E++P+WISE ASSGD+L ++K+ S +E+R+RLA+A Sbjct: 537 IVDRGEVEEQLKLLLEIVPDWISEKTASSGDSLCCVDKISSPEEIRQRLAEA 588 >emb|CBI37094.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E+E QL LL+EL+P WISE +ASSGD LL I K S + +R+RL +A Sbjct: 566 IVDRREVEEQLKLLQELVPEWISEKLASSGDLLLCIKKTSSPESIRQRLMEA 617 >ref|XP_008806924.1| PREDICTED: CDT1-like protein a, chloroplastic [Phoenix dactylifera] Length = 583 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQ 278 I DR E+E QL LL EL+P+WISE ASSGD L +NK+ S +E+R+RLA+ Sbjct: 531 IADRGEVEEQLELLLELVPDWISEKKASSGDILCCVNKITSPEEIRQRLAE 581 >emb|CDP03731.1| unnamed protein product [Coffea canephora] Length = 598 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 + DR+E+E QL LL+EL+P WI E +SSGD+LL +NK+ S + LR RLA+A Sbjct: 546 VVDRREVEEQLKLLRELVPEWIYEKSSSSGDSLLCVNKISSPEILRTRLAEA 597 >ref|XP_013631951.1| PREDICTED: LOW QUALITY PROTEIN: CDT1-like protein b [Brassica oleracea var. oleracea] Length = 462 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DRKE+E QL L+ +L+P+WISE AS GD L+ INKM + D +R RL +A Sbjct: 400 IMDRKEVEEQLRLMLQLVPDWISETKASFGDVLVSINKMSTPDTVRARLEEA 451 >ref|XP_010904590.1| PREDICTED: CDT1-like protein a, chloroplastic [Elaeis guineensis] Length = 589 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR E+E QL LL EL+P+WISE SSGD L ++K+ S +E+R+RLA+A Sbjct: 537 IVDRGEVEEQLKLLLELVPDWISEKTVSSGDILCCVDKISSAEEIRQRLAEA 588 >ref|XP_013742448.1| PREDICTED: CDT1-like protein b [Brassica napus] gi|923704848|ref|XP_013660703.1| PREDICTED: CDT1-like protein b [Brassica napus] gi|674920067|emb|CDY13226.1| BnaC04g26090D [Brassica napus] Length = 477 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DRKE+E QL L+ +L+P+WISE AS GD L+ INKM + D +R RL +A Sbjct: 415 IMDRKEVEEQLRLMLQLVPDWISETKASFGDVLVSINKMSTPDTVRARLEEA 466 >ref|XP_002532371.1| conserved hypothetical protein [Ricinus communis] gi|223527927|gb|EEF30014.1| conserved hypothetical protein [Ricinus communis] Length = 578 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E+E QL LL EL+P WIS+ +A+SGD+L INKM S + +R RL +A Sbjct: 526 IVDRREVEEQLDLLLELVPEWISKKLATSGDSLFCINKMSSPETIRARLEEA 577 >ref|XP_009803239.1| PREDICTED: CDT1-like protein a, chloroplastic [Nicotiana sylvestris] Length = 406 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -2 Query: 430 ITDRKEIEAQLTLLKELLPNWISEVVASSGDTLLRINKMRSTDELRRRLAQA 275 I DR+E+E +L+LL+EL P WI + VA+SGD LL +N++ S ELR RLA+A Sbjct: 345 IADRREVEEKLSLLQELAPEWIYKKVAASGDLLLCVNQISSPKELRTRLAEA 396