BLASTX nr result
ID: Papaver29_contig00055973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00055973 (497 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010910045.1| PREDICTED: staphylococcal nuclease domain-co... 72 2e-10 ref|XP_010250439.1| PREDICTED: staphylococcal nuclease domain-co... 72 2e-10 ref|XP_009403816.1| PREDICTED: staphylococcal nuclease domain-co... 72 2e-10 ref|XP_008812131.1| PREDICTED: staphylococcal nuclease domain-co... 72 2e-10 ref|XP_010908182.1| PREDICTED: staphylococcal nuclease domain-co... 71 3e-10 ref|XP_002273150.1| PREDICTED: staphylococcal nuclease domain-co... 71 3e-10 ref|XP_004138013.1| PREDICTED: staphylococcal nuclease domain-co... 71 3e-10 ref|XP_008464356.1| PREDICTED: staphylococcal nuclease domain-co... 71 3e-10 emb|CAN83456.1| hypothetical protein VITISV_034601 [Vitis vinifera] 71 3e-10 ref|XP_014509090.1| PREDICTED: staphylococcal nuclease domain-co... 71 4e-10 gb|KOM30501.1| hypothetical protein LR48_Vigan01g005500 [Vigna a... 71 4e-10 ref|XP_011003528.1| PREDICTED: staphylococcal nuclease domain-co... 71 4e-10 ref|XP_002511064.1| ebna2 binding protein P100, putative [Ricinu... 71 4e-10 ref|XP_002322312.1| 110 kDa 4SNc-Tudor domain family protein [Po... 71 4e-10 ref|XP_002318790.2| hypothetical protein POPTR_0012s11300g [Popu... 71 4e-10 ref|XP_014501824.1| PREDICTED: staphylococcal nuclease domain-co... 70 5e-10 gb|KOM40747.1| hypothetical protein LR48_Vigan04g094500 [Vigna a... 70 5e-10 gb|KHN31238.1| Nuclease domain-containing protein 1 [Glycine soja] 70 5e-10 gb|KHN09694.1| Nuclease domain-containing protein 1 [Glycine soja] 70 5e-10 ref|XP_010547787.1| PREDICTED: staphylococcal nuclease domain-co... 70 5e-10 >ref|XP_010910045.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Elaeis guineensis] Length = 985 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/44 (77%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D++VP+G PLAERR+NLSSIRSP++GNP RDE PAP Sbjct: 384 SGDCIIVADDSVPYGSPLAERRVNLSSIRSPRMGNPRRDEKPAP 427 >ref|XP_010250439.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Nelumbo nucifera] Length = 989 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D+++P+G PLAERR+NLSSIRSPK+GNP +DE PAP Sbjct: 388 SGDCIIVADDSIPYGSPLAERRVNLSSIRSPKIGNPRKDEKPAP 431 >ref|XP_009403816.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Musa acuminata subsp. malaccensis] Length = 982 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D+ VP+G PLAERR+NLSSIR+PK+GNP RDE PAP Sbjct: 388 SGDCIIVADDAVPYGSPLAERRVNLSSIRAPKMGNPRRDEKPAP 431 >ref|XP_008812131.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Phoenix dactylifera] Length = 986 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/44 (75%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDC+IV D++VP+G PLAERR+NLSSIRSP++GNP RDE PAP Sbjct: 384 SGDCVIVADDSVPYGSPLAERRVNLSSIRSPRMGNPRRDEKPAP 427 >ref|XP_010908182.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Elaeis guineensis] Length = 986 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D++VP+G P AERR+NLSS+RSPK+GNP RDE PAP Sbjct: 384 SGDCIIVADDSVPYGSPFAERRVNLSSVRSPKMGNPRRDEKPAP 427 >ref|XP_002273150.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Vitis vinifera] gi|296088151|emb|CBI35621.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D+++PFG PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 394 SGDCIIVADDSLPFGSPLAERRVNLSSIRCPKMGNPRRDERPAP 437 >ref|XP_004138013.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Cucumis sativus] gi|700208331|gb|KGN63427.1| hypothetical protein Csa_1G000020 [Cucumis sativus] Length = 988 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 392 SGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 435 >ref|XP_008464356.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Cucumis melo] gi|307135996|gb|ADN33852.1| short-chain dehydrogenase/reductase [Cucumis melo subsp. melo] Length = 988 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 392 SGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 435 >emb|CAN83456.1| hypothetical protein VITISV_034601 [Vitis vinifera] Length = 983 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D+++PFG PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 387 SGDCIIVADDSLPFGSPLAERRVNLSSIRCPKMGNPRRDERPAP 430 >ref|XP_014509090.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Vigna radiata var. radiata] Length = 990 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 390 SGDCIIVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 433 >gb|KOM30501.1| hypothetical protein LR48_Vigan01g005500 [Vigna angularis] Length = 947 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCIIV D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 390 SGDCIIVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 433 >ref|XP_011003528.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Populus euphratica] Length = 985 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDC+IV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 389 SGDCVIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_002511064.1| ebna2 binding protein P100, putative [Ricinus communis] gi|223550179|gb|EEF51666.1| ebna2 binding protein P100, putative [Ricinus communis] Length = 988 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDEPAPS 365 SGDCIIV D++VPFG PLAERR+NLSSIR PK+GNP RDE S Sbjct: 388 SGDCIIVADDSVPFGNPLAERRVNLSSIRCPKMGNPRRDEKPES 431 >ref|XP_002322312.1| 110 kDa 4SNc-Tudor domain family protein [Populus trichocarpa] gi|222869308|gb|EEF06439.1| 110 kDa 4SNc-Tudor domain family protein [Populus trichocarpa] Length = 984 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDC+IV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 389 SGDCVIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_002318790.2| hypothetical protein POPTR_0012s11300g [Populus trichocarpa] gi|550326869|gb|EEE97010.2| hypothetical protein POPTR_0012s11300g [Populus trichocarpa] Length = 970 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDC+IV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 389 SGDCVIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_014501824.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Vigna radiata var. radiata] Length = 993 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/44 (72%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCI+V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 390 SGDCIVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 433 >gb|KOM40747.1| hypothetical protein LR48_Vigan04g094500 [Vigna angularis] Length = 993 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/44 (72%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCI+V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 390 SGDCIVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 433 >gb|KHN31238.1| Nuclease domain-containing protein 1 [Glycine soja] Length = 990 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/44 (72%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCI+V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 390 SGDCIVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 433 >gb|KHN09694.1| Nuclease domain-containing protein 1 [Glycine soja] Length = 990 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/44 (72%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDCI+V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 389 SGDCIVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_010547787.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Tarenaya hassleriana] Length = 990 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/44 (72%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 496 SGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 368 SGDC+IV D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 393 SGDCVIVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 436