BLASTX nr result
ID: Papaver29_contig00055862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00055862 (962 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009378334.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 64 2e-07 ref|XP_014515057.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 61 1e-06 ref|XP_014515056.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 61 1e-06 gb|KOM30249.1| hypothetical protein LR48_Vigan1082s002100 [Vigna... 61 1e-06 ref|XP_010272779.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 61 1e-06 ref|XP_010272778.1| PREDICTED: F-box/LRR-repeat protein At4g1410... 61 1e-06 ref|XP_007135540.1| hypothetical protein PHAVU_010G138000g [Phas... 61 1e-06 gb|EMT05647.1| hypothetical protein F775_07611 [Aegilops tauschii] 60 3e-06 ref|XP_003608305.2| cytochrome C biogenesis protein ccsA [Medica... 60 3e-06 ref|XP_013457157.1| cytochrome C biogenesis protein ccsA [Medica... 60 3e-06 ref|XP_012077770.1| PREDICTED: putative F-box protein At1g58310 ... 58 1e-05 ref|XP_003531612.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 58 1e-05 >ref|XP_009378334.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220 [Pyrus x bretschneideri] Length = 289 Score = 63.5 bits (153), Expect = 2e-07 Identities = 33/68 (48%), Positives = 41/68 (60%) Frame = -1 Query: 206 TSSKLHCSSYNEQSLGCAELGEGSEFRVKKRSEDRISELPDALIHHIFSFLDMKYVVQTS 27 TS K H N +S +E GE E + R+ DRIS LPDA++H S L +K + QTS Sbjct: 28 TSFKSHEEYSNSKSSRASEPGEEEENKPHDRNSDRISNLPDAILHQTLSLLPIKTIAQTS 87 Query: 26 VLSRRWRY 3 VLSRRW Y Sbjct: 88 VLSRRWSY 95 >ref|XP_014515057.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220 isoform X2 [Vigna radiata var. radiata] Length = 408 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 113 SEDRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 SEDR+S++PD LIHHI SFL+ K +QTSVLS+RWRY Sbjct: 51 SEDRLSDMPDCLIHHILSFLETKDAIQTSVLSKRWRY 87 >ref|XP_014515056.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840 isoform X1 [Vigna radiata var. radiata] Length = 442 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 113 SEDRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 SEDR+S++PD LIHHI SFL+ K +QTSVLS+RWRY Sbjct: 51 SEDRLSDMPDCLIHHILSFLETKDAIQTSVLSKRWRY 87 >gb|KOM30249.1| hypothetical protein LR48_Vigan1082s002100 [Vigna angularis] Length = 442 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 113 SEDRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 SEDR+S++PD LIHHI SFL+ K +QTSVLS+RWRY Sbjct: 51 SEDRLSDMPDCLIHHILSFLETKDAIQTSVLSKRWRY 87 >ref|XP_010272779.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X2 [Nelumbo nucifera] Length = 456 Score = 61.2 bits (147), Expect = 1e-06 Identities = 32/67 (47%), Positives = 43/67 (64%) Frame = -1 Query: 203 SSKLHCSSYNEQSLGCAELGEGSEFRVKKRSEDRISELPDALIHHIFSFLDMKYVVQTSV 24 +SKL C S A+ + + R + DR+S LP+ ++HHI SFLDM+YVV+TS Sbjct: 3 ASKLPCYS-------AAKKSKTWDVRDMIENGDRLSSLPEKILHHILSFLDMRYVVRTSF 55 Query: 23 LSRRWRY 3 LSRRWRY Sbjct: 56 LSRRWRY 62 >ref|XP_010272778.1| PREDICTED: F-box/LRR-repeat protein At4g14103-like isoform X1 [Nelumbo nucifera] Length = 498 Score = 61.2 bits (147), Expect = 1e-06 Identities = 32/67 (47%), Positives = 43/67 (64%) Frame = -1 Query: 203 SSKLHCSSYNEQSLGCAELGEGSEFRVKKRSEDRISELPDALIHHIFSFLDMKYVVQTSV 24 +SKL C S A+ + + R + DR+S LP+ ++HHI SFLDM+YVV+TS Sbjct: 3 ASKLPCYS-------AAKKSKTWDVRDMIENGDRLSSLPEKILHHILSFLDMRYVVRTSF 55 Query: 23 LSRRWRY 3 LSRRWRY Sbjct: 56 LSRRWRY 62 >ref|XP_007135540.1| hypothetical protein PHAVU_010G138000g [Phaseolus vulgaris] gi|561008585|gb|ESW07534.1| hypothetical protein PHAVU_010G138000g [Phaseolus vulgaris] Length = 442 Score = 61.2 bits (147), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 113 SEDRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 SEDR+S++PD LIHHI SFL+ K +QTSVLS+RWRY Sbjct: 51 SEDRLSDMPDCLIHHILSFLETKDAIQTSVLSKRWRY 87 >gb|EMT05647.1| hypothetical protein F775_07611 [Aegilops tauschii] Length = 480 Score = 60.1 bits (144), Expect = 3e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = -1 Query: 143 EGSEFRVKKRSEDRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 EG + SEDRISELPD L+HH+ S L + VQTSVL+RRWRY Sbjct: 44 EGMRKKAVVTSEDRISELPDVLLHHVLSLLPVHEAVQTSVLARRWRY 90 >ref|XP_003608305.2| cytochrome C biogenesis protein ccsA [Medicago truncatula] gi|657389494|gb|AES90502.2| cytochrome C biogenesis protein ccsA [Medicago truncatula] Length = 490 Score = 59.7 bits (143), Expect = 3e-06 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = -1 Query: 203 SSKLHCSSYNEQSLGCAELGEGS--EFRVKKRSEDRISELPDALIHHIFSFLDMKYVVQT 30 S K CSS NE+S+ ++ + E + + SEDR+S+LPD +I HI SFL+ K+VV+T Sbjct: 10 SMKRPCSS-NEESMILEKMNKRRKCENQSNEESEDRLSDLPDGIILHILSFLNTKHVVRT 68 Query: 29 SVLSRRWRY 3 VLS+RWR+ Sbjct: 69 CVLSKRWRH 77 >ref|XP_013457157.1| cytochrome C biogenesis protein ccsA [Medicago truncatula] gi|657389493|gb|KEH31188.1| cytochrome C biogenesis protein ccsA [Medicago truncatula] Length = 470 Score = 59.7 bits (143), Expect = 3e-06 Identities = 33/69 (47%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = -1 Query: 203 SSKLHCSSYNEQSLGCAELGEGS--EFRVKKRSEDRISELPDALIHHIFSFLDMKYVVQT 30 S K CSS NE+S+ ++ + E + + SEDR+S+LPD +I HI SFL+ K+VV+T Sbjct: 10 SMKRPCSS-NEESMILEKMNKRRKCENQSNEESEDRLSDLPDGIILHILSFLNTKHVVRT 68 Query: 29 SVLSRRWRY 3 VLS+RWR+ Sbjct: 69 CVLSKRWRH 77 >ref|XP_012077770.1| PREDICTED: putative F-box protein At1g58310 [Jatropha curcas] gi|802633979|ref|XP_012077771.1| PREDICTED: putative F-box protein At1g58310 [Jatropha curcas] gi|643723847|gb|KDP33224.1| hypothetical protein JCGZ_12746 [Jatropha curcas] Length = 373 Score = 58.2 bits (139), Expect = 1e-05 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 107 DRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 DRISELPD+L+HHI SFL+ VV+TSVLS+RWRY Sbjct: 18 DRISELPDSLLHHILSFLNAMEVVRTSVLSKRWRY 52 >ref|XP_003531612.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840 [Glycine max] gi|734347213|gb|KHN11276.1| Putative F-box/FBD/LRR-repeat protein [Glycine soja] gi|947095546|gb|KRH44131.1| hypothetical protein GLYMA_08G192100 [Glycine max] Length = 450 Score = 58.2 bits (139), Expect = 1e-05 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -1 Query: 119 KRSEDRISELPDALIHHIFSFLDMKYVVQTSVLSRRWRY 3 + SEDR+S++PD +IHHI SF++ K +QT VLS+RWRY Sbjct: 52 EESEDRLSDMPDCIIHHILSFMETKDAIQTCVLSKRWRY 90