BLASTX nr result
ID: Papaver29_contig00055783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00055783 (493 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012086653.1| PREDICTED: transcription factor bHLH157 isof... 56 9e-06 >ref|XP_012086653.1| PREDICTED: transcription factor bHLH157 isoform X1 [Jatropha curcas] gi|643711811|gb|KDP25239.1| hypothetical protein JCGZ_20395 [Jatropha curcas] Length = 864 Score = 56.2 bits (134), Expect = 9e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 97 MNSGIKETLKCLCCNNGWSYGVFWRVNRQNPM 2 M S +KETLK LCC+NGWSYGVFWR++++N M Sbjct: 1 MGSVLKETLKSLCCSNGWSYGVFWRLDQRNSM 32