BLASTX nr result
ID: Papaver29_contig00055300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00055300 (643 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO35833.1| hypothetical protein CISIN_1g036099mg, partial [C... 67 1e-08 gb|KDO74739.1| hypothetical protein CISIN_1g041455mg, partial [C... 66 2e-08 ref|XP_006419858.1| hypothetical protein CICLE_v10006596mg, part... 66 2e-08 gb|KDO57130.1| hypothetical protein CISIN_1g043460mg [Citrus sin... 60 1e-06 >gb|KDO35833.1| hypothetical protein CISIN_1g036099mg, partial [Citrus sinensis] Length = 279 Score = 66.6 bits (161), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 394 DLVTEILCRLPIKSLTVFKCVSKSWNKLISRVCIPRIS 281 DL+TEILCRLP+KS+T FK VSK+WN LIS VCIPRIS Sbjct: 9 DLITEILCRLPVKSVTRFKIVSKAWNNLISNVCIPRIS 46 >gb|KDO74739.1| hypothetical protein CISIN_1g041455mg, partial [Citrus sinensis] Length = 286 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 403 LPIDLVTEILCRLPIKSLTVFKCVSKSWNKLISRVCIPRI 284 LP DL+TEILCRLP+KS+T FK VSK+W+ LIS VCIPRI Sbjct: 10 LPEDLITEILCRLPVKSVTGFKIVSKAWSNLISNVCIPRI 49 >ref|XP_006419858.1| hypothetical protein CICLE_v10006596mg, partial [Citrus clementina] gi|557521731|gb|ESR33098.1| hypothetical protein CICLE_v10006596mg, partial [Citrus clementina] Length = 350 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -1 Query: 403 LPIDLVTEILCRLPIKSLTVFKCVSKSWNKLISRVCIPRI 284 LP DL+TEILCRLP+KS+T FK VSK+W+ LIS VCIPRI Sbjct: 6 LPEDLITEILCRLPVKSVTGFKIVSKAWSNLISNVCIPRI 45 >gb|KDO57130.1| hypothetical protein CISIN_1g043460mg [Citrus sinensis] Length = 368 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 394 DLVTEILCRLPIKSLTVFKCVSKSWNKLISRVCIPRI 284 DL+TEIL RLP+KS+ FK VSK+WN LIS+VCIPRI Sbjct: 9 DLITEILSRLPVKSVVGFKIVSKTWNNLISKVCIPRI 45