BLASTX nr result
ID: Papaver29_contig00053817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00053817 (488 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN43482.1| Syntaxin-43 [Glycine soja] 57 5e-06 ref|NP_001239871.1| uncharacterized protein LOC100803629 [Glycin... 57 5e-06 >gb|KHN43482.1| Syntaxin-43 [Glycine soja] Length = 326 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 488 RAQRRGGMVTCATTLVLMCFVMMILLILKETLF 390 R Q++GGMV CATTLV+MCFVM++LLILKE LF Sbjct: 294 RTQKKGGMVMCATTLVIMCFVMLVLLILKEILF 326 >ref|NP_001239871.1| uncharacterized protein LOC100803629 [Glycine max] gi|255637864|gb|ACU19251.1| unknown [Glycine max] gi|947046863|gb|KRG96492.1| hypothetical protein GLYMA_19G214000 [Glycine max] Length = 324 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 488 RAQRRGGMVTCATTLVLMCFVMMILLILKETLF 390 R Q++GGMV CATTLV+MCFVM++LLILKE LF Sbjct: 292 RTQKKGGMVMCATTLVIMCFVMLVLLILKEILF 324