BLASTX nr result
ID: Papaver29_contig00053489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00053489 (584 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519348.1| Transcription factor HY5, putative [Ricinus ... 60 8e-07 emb|CBI26037.3| unnamed protein product [Vitis vinifera] gi|6125... 57 5e-06 ref|XP_002275566.2| PREDICTED: transcription factor HY5-like [Vi... 57 5e-06 emb|CAN81308.1| hypothetical protein VITISV_026539 [Vitis vinifera] 57 5e-06 >ref|XP_002519348.1| Transcription factor HY5, putative [Ricinus communis] gi|223541663|gb|EEF43212.1| Transcription factor HY5, putative [Ricinus communis] Length = 172 Score = 60.1 bits (144), Expect = 8e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 584 EKISTLTNENTMLRKVLMNTRPKVDETADIKHDHSGKT 471 EKISTL NEN MLRKVLMNTRPKVD++ D KHD G + Sbjct: 135 EKISTLINENAMLRKVLMNTRPKVDQSIDAKHDQLGNS 172 >emb|CBI26037.3| unnamed protein product [Vitis vinifera] gi|612567747|gb|AHX24181.1| basic leucine zipper transcription factor HYG2 [Vitis vinifera] Length = 186 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/39 (71%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 584 EKISTLTNENTMLRKVLMNTRPKVDETA-DIKHDHSGKT 471 EKISTL NENTMLRKVLMNTRPK+D+++ + KHD GK+ Sbjct: 148 EKISTLVNENTMLRKVLMNTRPKMDDSSTESKHDQLGKS 186 >ref|XP_002275566.2| PREDICTED: transcription factor HY5-like [Vitis vinifera] Length = 203 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/39 (71%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 584 EKISTLTNENTMLRKVLMNTRPKVDETA-DIKHDHSGKT 471 EKISTL NENTMLRKVLMNTRPK+D+++ + KHD GK+ Sbjct: 165 EKISTLVNENTMLRKVLMNTRPKMDDSSTESKHDQLGKS 203 >emb|CAN81308.1| hypothetical protein VITISV_026539 [Vitis vinifera] Length = 105 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/39 (71%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 584 EKISTLTNENTMLRKVLMNTRPKVDETA-DIKHDHSGKT 471 EKISTL NENTMLRKVLMNTRPK+D+++ + KHD GK+ Sbjct: 67 EKISTLVNENTMLRKVLMNTRPKMDDSSTESKHDQLGKS 105