BLASTX nr result
ID: Papaver29_contig00050473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00050473 (449 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274408.1| PREDICTED: cyclin-D2-1-like [Nelumbo nucifera] 57 4e-06 >ref|XP_010274408.1| PREDICTED: cyclin-D2-1-like [Nelumbo nucifera] Length = 351 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/53 (49%), Positives = 40/53 (75%) Frame = -2 Query: 439 PVSDEKHVKSQSGPPESPIGVIDAAACKSCDTQKSKSENPETIPVKPSSSKRR 281 P++ KH +++ PP SP+GV+DAAAC+SCDTQKS +ENP+ P + + ++R Sbjct: 290 PMARLKHRRTEPEPP-SPVGVLDAAACRSCDTQKSGAENPDPSPGELPNKRQR 341