BLASTX nr result
ID: Papaver29_contig00050166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00050166 (1694 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284552.1| PREDICTED: calcium-transporting ATPase 4, en... 58 6e-08 emb|CAN79679.1| hypothetical protein VITISV_034639 [Vitis vinifera] 58 6e-08 emb|CBI16213.3| unnamed protein product [Vitis vinifera] 58 6e-08 ref|XP_010259985.1| PREDICTED: calcium-transporting ATPase 4, en... 59 1e-07 ref|XP_009388640.1| PREDICTED: calcium-transporting ATPase 1, en... 57 2e-07 ref|XP_008369823.1| PREDICTED: calcium-transporting ATPase 1, en... 56 2e-07 ref|XP_010922444.1| PREDICTED: calcium-transporting ATPase 4, en... 57 6e-07 ref|XP_009341764.1| PREDICTED: calcium-transporting ATPase 4, en... 55 6e-07 ref|XP_008350412.1| PREDICTED: calcium-transporting ATPase 4, en... 55 8e-07 ref|XP_010937744.1| PREDICTED: calcium-transporting ATPase 4, en... 55 8e-07 ref|XP_009340896.1| PREDICTED: calcium-transporting ATPase 1, en... 55 1e-06 ref|XP_009340897.1| PREDICTED: calcium-transporting ATPase 1, en... 55 1e-06 ref|XP_009421359.1| PREDICTED: calcium-transporting ATPase 1, en... 54 1e-06 ref|XP_008783614.1| PREDICTED: calcium-transporting ATPase 1, en... 54 1e-06 ref|XP_004493912.1| PREDICTED: calcium-transporting ATPase 4, en... 54 1e-06 ref|XP_010920750.1| PREDICTED: calcium-transporting ATPase 4, en... 54 1e-06 ref|XP_006424716.1| hypothetical protein CICLE_v10027724mg [Citr... 54 2e-06 ref|XP_009392704.1| PREDICTED: calcium-transporting ATPase 1, en... 54 2e-06 gb|KDO73014.1| hypothetical protein CISIN_1g001751mg [Citrus sin... 54 2e-06 gb|KDO73015.1| hypothetical protein CISIN_1g001751mg [Citrus sin... 54 2e-06 >ref|XP_002284552.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Vitis vinifera] gi|731392391|ref|XP_010651081.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Vitis vinifera] Length = 1061 Score = 58.2 bits (139), Expect(2) = 6e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G++V+LDR S +LIL+S Y +S + LRCLGFAYK++L EFA Y Sbjct: 549 LLDGSIVELDRKSRDLILQSLYQMSTSALRCLGFAYKEDLLEFATY 594 Score = 28.5 bits (62), Expect(2) = 6e-08 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL PSNY Sbjct: 599 DHPAHQLLLRPSNY 612 >emb|CAN79679.1| hypothetical protein VITISV_034639 [Vitis vinifera] Length = 1061 Score = 58.2 bits (139), Expect(2) = 6e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G++V+LDR S +LIL+S Y +S + LRCLGFAYK++L EFA Y Sbjct: 549 LLDGSIVELDRKSRDLILQSLYQMSTSALRCLGFAYKEDLLEFATY 594 Score = 28.5 bits (62), Expect(2) = 6e-08 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL PSNY Sbjct: 599 DHPAHQLLLRPSNY 612 >emb|CBI16213.3| unnamed protein product [Vitis vinifera] Length = 855 Score = 58.2 bits (139), Expect(2) = 6e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G++V+LDR S +LIL+S Y +S + LRCLGFAYK++L EFA Y Sbjct: 470 LLDGSIVELDRKSRDLILQSLYQMSTSALRCLGFAYKEDLLEFATY 515 Score = 28.5 bits (62), Expect(2) = 6e-08 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL PSNY Sbjct: 520 DHPAHQLLLRPSNY 533 >ref|XP_010259985.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Nelumbo nucifera] Length = 1060 Score = 59.3 bits (142), Expect(2) = 1e-07 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV LD SS +LIL S + +S T LRCLGFAYKDELAEF Y Sbjct: 547 LLDGSVVTLDHSSRDLILRSLHEMSTTALRCLGFAYKDELAEFVTY 592 Score = 26.6 bits (57), Expect(2) = 1e-07 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 +HPA+++LL PSNY + E D + Sbjct: 598 NHPAHDLLLKPSNYSAI--ESDLI 619 >ref|XP_009388640.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like [Musa acuminata subsp. malaccensis] Length = 1064 Score = 56.6 bits (135), Expect(2) = 2e-07 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+V++LD S+ NL+LE+ + +S LRCLGFAYKD+++EFA Y Sbjct: 555 LLDGSVMQLDESTKNLVLEALHEMSTNALRCLGFAYKDDISEFATY 600 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 DHPA+++LL PSNY + E FV Sbjct: 604 DHPAHKLLLDPSNYSSVESELIFV 627 >ref|XP_008369823.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like [Malus domestica] Length = 1063 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL GTVV LD SS N I+++ + +S + LRCLGFAYKDEL EF+ Y Sbjct: 552 LLDGTVVPLDDSSRNYIMQALHEMSTSALRCLGFAYKDELGEFSSY 597 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 DHPA+ +LL PSNY + E FV Sbjct: 602 DHPAHRLLLDPSNYSSIESELVFV 625 >ref|XP_010922444.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Elaeis guineensis] Length = 1125 Score = 56.6 bits (135), Expect(2) = 6e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 L+ G+VV+LD S+ LILE+ +G+S LRCLGFAYK++L+EFA Y Sbjct: 620 LIDGSVVQLDESTKGLILEALHGMSSNALRCLGFAYKNDLSEFATY 665 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 +HPA++ILL PSNY Sbjct: 669 NHPAHKILLDPSNY 682 >ref|XP_009341764.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Pyrus x bretschneideri] Length = 1063 Score = 55.5 bits (132), Expect(2) = 6e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL GTVV LD SS N I+E+ + +S LRCLGFAYKDEL EF Y Sbjct: 552 LLDGTVVPLDDSSRNYIVEALHEMSTIALRCLGFAYKDELGEFESY 597 Score = 27.7 bits (60), Expect(2) = 6e-07 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 DHPA+ +LL PSNY + E D V Sbjct: 602 DHPAHRLLLDPSNYSSI--ESDLV 623 >ref|XP_008350412.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Malus domestica] Length = 1063 Score = 55.5 bits (132), Expect(2) = 8e-07 Identities = 29/46 (63%), Positives = 33/46 (71%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL GTVV LD SS N I+E+ + +S LRCLGFAYKDEL EF Y Sbjct: 552 LLDGTVVPLDDSSRNYIVEALHEMSTIALRCLGFAYKDELGEFESY 597 Score = 27.3 bits (59), Expect(2) = 8e-07 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+ +LL PSNY Sbjct: 602 DHPAHRLLLDPSNY 615 >ref|XP_010937744.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Elaeis guineensis] Length = 1057 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV LD SS LIL++ + +S LRCLGFAYKD+L+EFA Y Sbjct: 548 LLDGSVVLLDESSKGLILKALHEMSTNTLRCLGFAYKDDLSEFATY 593 Score = 27.7 bits (60), Expect(2) = 8e-07 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL PSNY Sbjct: 597 DHPAHKLLLDPSNY 610 >ref|XP_009340896.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like isoform X1 [Pyrus x bretschneideri] Length = 1074 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL GTVV LD SS N I+++ +S + LRCLGFAYKDEL EF+ Y Sbjct: 552 LLDGTVVPLDDSSRNYIMQALNEMSTSALRCLGFAYKDELGEFSSY 597 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 DHPA+ +LL PSNY + E D V Sbjct: 602 DHPAHRLLLDPSNYSSI--ESDLV 623 >ref|XP_009340897.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like isoform X2 [Pyrus x bretschneideri] Length = 1063 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL GTVV LD SS N I+++ +S + LRCLGFAYKDEL EF+ Y Sbjct: 552 LLDGTVVPLDDSSRNYIMQALNEMSTSALRCLGFAYKDELGEFSSY 597 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 DHPA+ +LL PSNY + E D V Sbjct: 602 DHPAHRLLLDPSNYSSI--ESDLV 623 >ref|XP_009421359.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like [Musa acuminata subsp. malaccensis] Length = 1059 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV LD S +LIL++ + +S T LRCLGFAY D+LAEFA Y Sbjct: 548 LLDGSVVVLDDRSKSLILDALHKMSTTALRCLGFAYTDDLAEFATY 593 Score = 28.5 bits (62), Expect(2) = 1e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA++ILL PSNY Sbjct: 597 DHPAHKILLDPSNY 610 >ref|XP_008783614.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like [Phoenix dactylifera] Length = 1061 Score = 53.9 bits (128), Expect(2) = 1e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV+LD S+ LILE +S LRCLGFAYKD+L+EFA Y Sbjct: 552 LLDGSVVQLDESTKGLILEVLRDMSSNALRCLGFAYKDDLSEFATY 597 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+ ILL PSNY Sbjct: 601 DHPAHRILLDPSNY 614 >ref|XP_004493912.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Cicer arietinum] Length = 1058 Score = 54.3 bits (129), Expect(2) = 1e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -2 Query: 1669 GTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 G++VKLD ++ NLIL++ + +S + LRCLGFAYKDELA F Y Sbjct: 554 GSIVKLDNNAKNLILQALHEMSTSALRCLGFAYKDELANFENY 596 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 1527 DHPANEILLHPSNYLCLWPEGDFV 1456 DHP +++LL PSNY + E FV Sbjct: 601 DHPGHQLLLDPSNYSSIEKELIFV 624 >ref|XP_010920750.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like [Elaeis guineensis] Length = 1057 Score = 54.3 bits (129), Expect(2) = 1e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G++V LD SS LIL++ + +S LRCLGFAYKD+LAEF+ Y Sbjct: 548 LLDGSIVLLDESSKGLILKALHEMSTDALRCLGFAYKDDLAEFSTY 593 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL PSNY Sbjct: 597 DHPAHKLLLDPSNY 610 >ref|XP_006424716.1| hypothetical protein CICLE_v10027724mg [Citrus clementina] gi|568870060|ref|XP_006488230.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like isoform X1 [Citrus sinensis] gi|568870062|ref|XP_006488231.1| PREDICTED: calcium-transporting ATPase 4, endoplasmic reticulum-type-like isoform X2 [Citrus sinensis] gi|557526650|gb|ESR37956.1| hypothetical protein CICLE_v10027724mg [Citrus clementina] Length = 1064 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV+LD+ S +LIL+S +S T LRCLGFAYKD+L EF Y Sbjct: 551 LLDGSVVELDQYSRDLILQSLQEMSSTALRCLGFAYKDDLREFETY 596 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 9/14 (64%), Positives = 14/14 (100%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL+P+NY Sbjct: 601 DHPAHQLLLNPTNY 614 >ref|XP_009392704.1| PREDICTED: calcium-transporting ATPase 1, endoplasmic reticulum-type-like [Musa acuminata subsp. malaccensis] Length = 1059 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV LD SS NLI+ + +S LRCLGFAYKD+LAEF+ Y Sbjct: 548 LLDGSVVLLDDSSKNLIMNALREMSTNALRCLGFAYKDDLAEFSAY 593 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL PSNY Sbjct: 597 DHPAHKLLLDPSNY 610 >gb|KDO73014.1| hypothetical protein CISIN_1g001751mg [Citrus sinensis] Length = 1018 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV+LD+ S +LIL+S +S T LRCLGFAYKD+L EF Y Sbjct: 551 LLDGSVVELDQYSRDLILQSLQEMSSTALRCLGFAYKDDLREFETY 596 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 9/14 (64%), Positives = 14/14 (100%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL+P+NY Sbjct: 601 DHPAHQLLLNPTNY 614 >gb|KDO73015.1| hypothetical protein CISIN_1g001751mg [Citrus sinensis] Length = 817 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 1678 LLVGTVVKLDRSS*NLILESPYGISLTVLRCLGFAYKDELAEFAPY 1541 LL G+VV+LD+ S +LIL+S +S T LRCLGFAYKD+L EF Y Sbjct: 551 LLDGSVVELDQYSRDLILQSLQEMSSTALRCLGFAYKDDLREFETY 596 Score = 27.7 bits (60), Expect(2) = 2e-06 Identities = 9/14 (64%), Positives = 14/14 (100%) Frame = -3 Query: 1527 DHPANEILLHPSNY 1486 DHPA+++LL+P+NY Sbjct: 601 DHPAHQLLLNPTNY 614