BLASTX nr result
ID: Papaver29_contig00050087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00050087 (595 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010256333.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_007142200.1| hypothetical protein PHAVU_008G260600g [Phas... 94 5e-17 ref|XP_010061262.1| PREDICTED: pentatricopeptide repeat-containi... 94 7e-17 gb|KCW68187.1| hypothetical protein EUGRSUZ_F01856 [Eucalyptus g... 94 7e-17 ref|XP_006596427.1| PREDICTED: pentatricopeptide repeat-containi... 93 1e-16 ref|XP_014502595.1| PREDICTED: pentatricopeptide repeat-containi... 92 2e-16 ref|XP_006575412.1| PREDICTED: pentatricopeptide repeat-containi... 91 3e-16 ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containi... 90 8e-16 ref|XP_010459647.1| PREDICTED: pentatricopeptide repeat-containi... 90 1e-15 ref|XP_010459646.1| PREDICTED: pentatricopeptide repeat-containi... 90 1e-15 gb|KFK44091.1| hypothetical protein AALP_AA1G214900 [Arabis alpina] 88 4e-15 ref|XP_006416469.1| hypothetical protein EUTSA_v10006756mg [Eutr... 87 5e-15 ref|XP_003615696.1| PPR containing plant-like protein [Medicago ... 87 7e-15 emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] 87 9e-15 ref|NP_173402.2| pentatricopeptide repeat-containing protein [Ar... 87 9e-15 ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfam... 86 2e-14 gb|KNA14258.1| hypothetical protein SOVF_109110 [Spinacia oleracea] 85 2e-14 ref|XP_010672638.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 ref|XP_009598735.1| PREDICTED: pentatricopeptide repeat-containi... 85 3e-14 ref|XP_009603001.1| PREDICTED: pentatricopeptide repeat-containi... 85 3e-14 >ref|XP_010256333.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nelumbo nucifera] Length = 898 Score = 96.3 bits (238), Expect = 1e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH+TAK ISLRYGCEIYL+DP C HHFK+G CSCKDYW Sbjct: 852 VKNLRMCRDCHRTAKLISLRYGCEIYLSDPNCFHHFKNGKCSCKDYW 898 >ref|XP_007142200.1| hypothetical protein PHAVU_008G260600g [Phaseolus vulgaris] gi|561015333|gb|ESW14194.1| hypothetical protein PHAVU_008G260600g [Phaseolus vulgaris] Length = 893 Score = 94.0 bits (232), Expect = 5e-17 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLRVC DCH TAK+ISL YGCEIYL+D CLHHFKDG CSC+DYW Sbjct: 847 VKNLRVCKDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 893 >ref|XP_010061262.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Eucalyptus grandis] Length = 895 Score = 93.6 bits (231), Expect = 7e-17 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 +KN R+C DCHKTAK+++L YGCEIYL+D KCLHHFKDGVCSC+DYW Sbjct: 849 MKNSRMCVDCHKTAKYVTLSYGCEIYLSDSKCLHHFKDGVCSCRDYW 895 >gb|KCW68187.1| hypothetical protein EUGRSUZ_F01856 [Eucalyptus grandis] Length = 844 Score = 93.6 bits (231), Expect = 7e-17 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 +KN R+C DCHKTAK+++L YGCEIYL+D KCLHHFKDGVCSC+DYW Sbjct: 798 MKNSRMCVDCHKTAKYVTLSYGCEIYLSDSKCLHHFKDGVCSCRDYW 844 >ref|XP_006596427.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Glycine max] gi|947067903|gb|KRH17046.1| hypothetical protein GLYMA_14G194400 [Glycine max] Length = 896 Score = 92.8 bits (229), Expect = 1e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH TAK+ISL YGCEIYL+D CLHHFKDG CSC+DYW Sbjct: 850 VKNLRMCRDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 896 >ref|XP_014502595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Vigna radiata var. radiata] Length = 893 Score = 92.0 bits (227), Expect = 2e-16 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH TAK+ISL YGCEIYL+D CLHHFKDG CSC DYW Sbjct: 847 VKNLRMCKDCHDTAKYISLAYGCEIYLSDSNCLHHFKDGHCSCNDYW 893 >ref|XP_006575412.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X1 [Glycine max] gi|571441335|ref|XP_006575413.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like isoform X2 [Glycine max] gi|734432085|gb|KHN46148.1| Pentatricopeptide repeat-containing protein [Glycine soja] gi|947124477|gb|KRH72683.1| hypothetical protein GLYMA_02G227300 [Glycine max] Length = 896 Score = 91.3 bits (225), Expect = 3e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH +AK+ISL YGCEIYL+D CLHHFKDG CSC+DYW Sbjct: 850 VKNLRMCRDCHDSAKYISLAYGCEIYLSDSNCLHHFKDGHCSCRDYW 896 >ref|XP_004490605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Cicer arietinum] Length = 888 Score = 90.1 bits (222), Expect = 8e-16 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH TAK+ISL YGCEIYL+D CLHHFK G CSC+DYW Sbjct: 842 VKNLRMCRDCHDTAKYISLAYGCEIYLSDSNCLHHFKGGHCSCRDYW 888 >ref|XP_010459647.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 isoform X2 [Camelina sativa] Length = 895 Score = 89.7 bits (221), Expect = 1e-15 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH TAK++S RYGC+I L+D KCLHHFK+G CSCKDYW Sbjct: 849 VKNLRMCRDCHNTAKYVSKRYGCDILLDDTKCLHHFKNGDCSCKDYW 895 >ref|XP_010459646.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 isoform X1 [Camelina sativa] Length = 895 Score = 89.7 bits (221), Expect = 1e-15 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH TAK++S RYGC+I L+D KCLHHFK+G CSCKDYW Sbjct: 849 VKNLRMCRDCHNTAKYVSKRYGCDILLDDTKCLHHFKNGDCSCKDYW 895 >gb|KFK44091.1| hypothetical protein AALP_AA1G214900 [Arabis alpina] Length = 894 Score = 87.8 bits (216), Expect = 4e-15 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 +KNLR+C DCH TAK+IS RY C+I+L D +CLHHFK+GVCSC+DYW Sbjct: 848 LKNLRMCRDCHNTAKYISKRYDCDIFLEDTRCLHHFKNGVCSCRDYW 894 >ref|XP_006416469.1| hypothetical protein EUTSA_v10006756mg [Eutrema salsugineum] gi|557094240|gb|ESQ34822.1| hypothetical protein EUTSA_v10006756mg [Eutrema salsugineum] Length = 893 Score = 87.4 bits (215), Expect = 5e-15 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 +KNLR+C DCH TAK+IS RYGC+I L D +CLHHFK+G CSCKDYW Sbjct: 847 LKNLRMCRDCHNTAKYISRRYGCDILLEDTRCLHHFKNGDCSCKDYW 893 >ref|XP_003615696.1| PPR containing plant-like protein [Medicago truncatula] gi|355517031|gb|AES98654.1| PPR containing plant-like protein [Medicago truncatula] Length = 887 Score = 87.0 bits (214), Expect = 7e-15 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VK LR+C DCH TAK+IS+ YGCEIYL+D CLHHFK G CSC+DYW Sbjct: 841 VKKLRMCRDCHDTAKYISMAYGCEIYLSDSNCLHHFKGGHCSCRDYW 887 >emb|CAA06829.1| DYW7 protein [Arabidopsis thaliana] Length = 406 Score = 86.7 bits (213), Expect = 9e-15 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 +KNLR+C DCH TAK++S RYGC+I L D +CLHHFK+G CSCKDYW Sbjct: 360 LKNLRMCRDCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 406 >ref|NP_173402.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75263158|sp|Q9FXH1.1|PPR52_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g19720; AltName: Full=Protein DYW7 gi|10086495|gb|AAG12555.1|AC007797_15 Unknown Protein [Arabidopsis thaliana] gi|332191770|gb|AEE29891.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 894 Score = 86.7 bits (213), Expect = 9e-15 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 +KNLR+C DCH TAK++S RYGC+I L D +CLHHFK+G CSCKDYW Sbjct: 848 LKNLRMCRDCHDTAKYVSKRYGCDILLEDTRCLHHFKNGDCSCKDYW 894 >ref|XP_007017649.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590593723|ref|XP_007017650.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722977|gb|EOY14874.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508722978|gb|EOY14875.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 890 Score = 85.5 bits (210), Expect = 2e-14 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKN R+C++CH TAK+ISL++GCEIYL+D KC HHFK+G CSC DYW Sbjct: 844 VKNTRMCSNCHLTAKYISLKFGCEIYLSDRKCFHHFKNGQCSCGDYW 890 >gb|KNA14258.1| hypothetical protein SOVF_109110 [Spinacia oleracea] Length = 887 Score = 85.1 bits (209), Expect = 2e-14 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKN R+C DCH TAK+IS YGCEI L+D KCLHHFK+G CSC DYW Sbjct: 841 VKNFRICEDCHCTAKYISSAYGCEILLSDTKCLHHFKEGKCSCGDYW 887 >ref|XP_010672638.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Beta vulgaris subsp. vulgaris] gi|870869946|gb|KMT20691.1| hypothetical protein BVRB_1g006660 [Beta vulgaris subsp. vulgaris] Length = 887 Score = 85.1 bits (209), Expect = 2e-14 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 591 KNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 KN R+C DCH+TAK+IS YGCEI L+D KCLHHFK+G CSC DYW Sbjct: 842 KNFRICEDCHRTAKYISSAYGCEILLSDTKCLHHFKEGRCSCGDYW 887 >ref|XP_009598735.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tomentosiformis] gi|697179506|ref|XP_009598736.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tomentosiformis] gi|697179508|ref|XP_009598737.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tomentosiformis] gi|697179510|ref|XP_009598738.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Nicotiana tomentosiformis] Length = 251 Score = 84.7 bits (208), Expect = 3e-14 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH+TAKFIS +Y EIY++D KCLHHFKDG CSC +YW Sbjct: 205 VKNLRMCEDCHRTAKFISQKYEREIYIHDSKCLHHFKDGYCSCGNYW 251 >ref|XP_009603001.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nicotiana tomentosiformis] gi|697102779|ref|XP_009603007.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nicotiana tomentosiformis] gi|697102781|ref|XP_009603014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 [Nicotiana tomentosiformis] Length = 879 Score = 84.7 bits (208), Expect = 3e-14 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 594 VKNLRVCNDCHKTAKFISLRYGCEIYLNDPKCLHHFKDGVCSCKDYW 454 VKNLR+C DCH+TAKFIS +Y EIY++D KCLHHFKDG CSC +YW Sbjct: 833 VKNLRMCEDCHRTAKFISQKYEREIYIHDSKCLHHFKDGYCSCGNYW 879