BLASTX nr result
ID: Papaver29_contig00049575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00049575 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014520002.1| PREDICTED: serine carboxypeptidase-like 51 [... 114 3e-23 gb|KOM50619.1| hypothetical protein LR48_Vigan08g144600 [Vigna a... 114 3e-23 ref|XP_007132357.1| hypothetical protein PHAVU_011G087900g [Phas... 113 5e-23 ref|XP_004294057.1| PREDICTED: serine carboxypeptidase-like 51 [... 113 5e-23 ref|XP_009804891.1| PREDICTED: serine carboxypeptidase-like 51 [... 113 6e-23 ref|XP_009620142.1| PREDICTED: serine carboxypeptidase-like 51 [... 113 6e-23 ref|XP_003539799.1| PREDICTED: serine carboxypeptidase-like 51-l... 113 6e-23 gb|KDO60316.1| hypothetical protein CISIN_1g0122372mg [Citrus si... 112 8e-23 gb|KDO60315.1| hypothetical protein CISIN_1g0122372mg, partial [... 112 8e-23 gb|KDO60312.1| hypothetical protein CISIN_1g0122372mg, partial [... 112 8e-23 ref|XP_006487987.1| PREDICTED: serine carboxypeptidase-like 51-l... 112 8e-23 ref|XP_006487986.1| PREDICTED: serine carboxypeptidase-like 51-l... 112 8e-23 ref|XP_006424421.1| hypothetical protein CICLE_v10029856mg [Citr... 112 8e-23 ref|XP_010523125.1| PREDICTED: serine carboxypeptidase-like 51 [... 112 1e-22 emb|CBI17117.3| unnamed protein product [Vitis vinifera] 112 1e-22 ref|XP_002273519.1| PREDICTED: serine carboxypeptidase-like 51 [... 112 1e-22 ref|XP_006349126.1| PREDICTED: serine carboxypeptidase-like 51-l... 112 1e-22 emb|CAN75395.1| hypothetical protein VITISV_004140 [Vitis vinifera] 112 1e-22 ref|XP_003538156.1| PREDICTED: serine carboxypeptidase-like 51-l... 111 2e-22 ref|XP_010241642.1| PREDICTED: serine carboxypeptidase-like 51 i... 110 3e-22 >ref|XP_014520002.1| PREDICTED: serine carboxypeptidase-like 51 [Vigna radiata var. radiata] Length = 458 Score = 114 bits (285), Expect = 3e-23 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYV+VRPK HMFWW+YRSPYRVEDPSKPWPI+LWLQGGPGASGVG Sbjct: 29 QDGSEEWGYVQVRPKAHMFWWLYRSPYRVEDPSKPWPIVLWLQGGPGASGVG 80 >gb|KOM50619.1| hypothetical protein LR48_Vigan08g144600 [Vigna angularis] Length = 399 Score = 114 bits (285), Expect = 3e-23 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYV+VRPK HMFWW+YRSPYRVEDPSKPWPI+LWLQGGPGASGVG Sbjct: 29 QDGSEEWGYVQVRPKAHMFWWLYRSPYRVEDPSKPWPIVLWLQGGPGASGVG 80 >ref|XP_007132357.1| hypothetical protein PHAVU_011G087900g [Phaseolus vulgaris] gi|561005357|gb|ESW04351.1| hypothetical protein PHAVU_011G087900g [Phaseolus vulgaris] Length = 458 Score = 113 bits (283), Expect = 5e-23 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYV VRPK HMFWW+YRSPYRVEDPSKPWPIILWLQGGPGASGVG Sbjct: 29 QDGSEEWGYVPVRPKAHMFWWLYRSPYRVEDPSKPWPIILWLQGGPGASGVG 80 >ref|XP_004294057.1| PREDICTED: serine carboxypeptidase-like 51 [Fragaria vesca subsp. vesca] Length = 473 Score = 113 bits (283), Expect = 5e-23 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 +D SE WGYVEVRPK HMFWW+YRSPYRVEDPSKPWPIILWLQGGPGASGVG Sbjct: 31 KDGSEDWGYVEVRPKAHMFWWLYRSPYRVEDPSKPWPIILWLQGGPGASGVG 82 >ref|XP_009804891.1| PREDICTED: serine carboxypeptidase-like 51 [Nicotiana sylvestris] Length = 463 Score = 113 bits (282), Expect = 6e-23 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE WGYVEVRPK HMFWW YRSPYRVEDP+KPWPIILWLQGGPGASGVG Sbjct: 36 QDASESWGYVEVRPKAHMFWWYYRSPYRVEDPNKPWPIILWLQGGPGASGVG 87 >ref|XP_009620142.1| PREDICTED: serine carboxypeptidase-like 51 [Nicotiana tomentosiformis] Length = 463 Score = 113 bits (282), Expect = 6e-23 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE WGYVEVRPK HMFWW YRSPYRVEDP+KPWPIILWLQGGPGASGVG Sbjct: 36 QDASESWGYVEVRPKAHMFWWYYRSPYRVEDPNKPWPIILWLQGGPGASGVG 87 >ref|XP_003539799.1| PREDICTED: serine carboxypeptidase-like 51-like [Glycine max] gi|734375854|gb|KHN21092.1| Serine carboxypeptidase-like 51 [Glycine soja] gi|947076294|gb|KRH25134.1| hypothetical protein GLYMA_12G083100 [Glycine max] gi|947076295|gb|KRH25135.1| hypothetical protein GLYMA_12G083100 [Glycine max] Length = 459 Score = 113 bits (282), Expect = 6e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYV+VRPK HMFWW+Y+SPYRVEDPSKPWPI+LWLQGGPGASGVG Sbjct: 30 QDGSEEWGYVQVRPKAHMFWWLYKSPYRVEDPSKPWPIVLWLQGGPGASGVG 81 >gb|KDO60316.1| hypothetical protein CISIN_1g0122372mg [Citrus sinensis] Length = 358 Score = 112 bits (281), Expect = 8e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYVEVRPK HMFWW+Y+SPYR+E+PSKPWPIILWLQGGPGASGVG Sbjct: 32 QDASEEWGYVEVRPKAHMFWWLYKSPYRIENPSKPWPIILWLQGGPGASGVG 83 >gb|KDO60315.1| hypothetical protein CISIN_1g0122372mg, partial [Citrus sinensis] Length = 435 Score = 112 bits (281), Expect = 8e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYVEVRPK HMFWW+Y+SPYR+E+PSKPWPIILWLQGGPGASGVG Sbjct: 32 QDASEEWGYVEVRPKAHMFWWLYKSPYRIENPSKPWPIILWLQGGPGASGVG 83 >gb|KDO60312.1| hypothetical protein CISIN_1g0122372mg, partial [Citrus sinensis] gi|641841400|gb|KDO60313.1| hypothetical protein CISIN_1g0122372mg, partial [Citrus sinensis] gi|641841401|gb|KDO60314.1| hypothetical protein CISIN_1g0122372mg, partial [Citrus sinensis] Length = 436 Score = 112 bits (281), Expect = 8e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYVEVRPK HMFWW+Y+SPYR+E+PSKPWPIILWLQGGPGASGVG Sbjct: 32 QDASEEWGYVEVRPKAHMFWWLYKSPYRIENPSKPWPIILWLQGGPGASGVG 83 >ref|XP_006487987.1| PREDICTED: serine carboxypeptidase-like 51-like isoform X2 [Citrus sinensis] Length = 448 Score = 112 bits (281), Expect = 8e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYVEVRPK HMFWW+Y+SPYR+E+PSKPWPIILWLQGGPGASGVG Sbjct: 32 QDASEEWGYVEVRPKAHMFWWLYKSPYRIENPSKPWPIILWLQGGPGASGVG 83 >ref|XP_006487986.1| PREDICTED: serine carboxypeptidase-like 51-like isoform X1 [Citrus sinensis] Length = 466 Score = 112 bits (281), Expect = 8e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYVEVRPK HMFWW+Y+SPYR+E+PSKPWPIILWLQGGPGASGVG Sbjct: 32 QDASEEWGYVEVRPKAHMFWWLYKSPYRIENPSKPWPIILWLQGGPGASGVG 83 >ref|XP_006424421.1| hypothetical protein CICLE_v10029856mg [Citrus clementina] gi|557526355|gb|ESR37661.1| hypothetical protein CICLE_v10029856mg [Citrus clementina] Length = 464 Score = 112 bits (281), Expect = 8e-23 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYVEVRPK HMFWW+Y+SPYR+E+PSKPWPIILWLQGGPGASGVG Sbjct: 32 QDASEEWGYVEVRPKAHMFWWLYKSPYRIENPSKPWPIILWLQGGPGASGVG 83 >ref|XP_010523125.1| PREDICTED: serine carboxypeptidase-like 51 [Tarenaya hassleriana] Length = 391 Score = 112 bits (280), Expect = 1e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -3 Query: 158 DESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 D SE WGYVEVRPK HMFWW+YRSPYRVEDPSKPWP+ILWLQGGPGASGVG Sbjct: 31 DGSEAWGYVEVRPKAHMFWWLYRSPYRVEDPSKPWPVILWLQGGPGASGVG 81 >emb|CBI17117.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 112 bits (280), Expect = 1e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD +E+WGYVEVRPK HMFWW+YRSPYRVE PSKPWPIILWLQGGPGASGVG Sbjct: 8 QDGTEEWGYVEVRPKAHMFWWLYRSPYRVESPSKPWPIILWLQGGPGASGVG 59 >ref|XP_002273519.1| PREDICTED: serine carboxypeptidase-like 51 [Vitis vinifera] gi|731394192|ref|XP_010651749.1| PREDICTED: serine carboxypeptidase-like 51 [Vitis vinifera] Length = 465 Score = 112 bits (280), Expect = 1e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD +E+WGYVEVRPK HMFWW+YRSPYRVE PSKPWPIILWLQGGPGASGVG Sbjct: 37 QDGTEEWGYVEVRPKAHMFWWLYRSPYRVESPSKPWPIILWLQGGPGASGVG 88 >ref|XP_006349126.1| PREDICTED: serine carboxypeptidase-like 51-like, partial [Solanum tuberosum] Length = 456 Score = 112 bits (280), Expect = 1e-22 Identities = 47/53 (88%), Positives = 48/53 (90%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVGT 3 QD SE WGYVEVRPK HMFWW YRS YRVEDP+KPWPIILWLQGGPGASGVGT Sbjct: 28 QDSSESWGYVEVRPKAHMFWWYYRSSYRVEDPNKPWPIILWLQGGPGASGVGT 80 >emb|CAN75395.1| hypothetical protein VITISV_004140 [Vitis vinifera] Length = 458 Score = 112 bits (280), Expect = 1e-22 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD +E+WGYVEVRPK HMFWW+YRSPYRVE PSKPWPIILWLQGGPGASGVG Sbjct: 30 QDGTEEWGYVEVRPKAHMFWWLYRSPYRVESPSKPWPIILWLQGGPGASGVG 81 >ref|XP_003538156.1| PREDICTED: serine carboxypeptidase-like 51-like [Glycine max] gi|734416975|gb|KHN38692.1| Serine carboxypeptidase-like 51 [Glycine soja] gi|947081752|gb|KRH30541.1| hypothetical protein GLYMA_11G191200 [Glycine max] Length = 458 Score = 111 bits (277), Expect = 2e-22 Identities = 45/52 (86%), Positives = 49/52 (94%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 QD SE+WGYV+VRPK HMFWW Y+SPYRVEDPSKPWPI+LWLQGGPGASGVG Sbjct: 30 QDGSEEWGYVQVRPKAHMFWWHYKSPYRVEDPSKPWPIVLWLQGGPGASGVG 81 >ref|XP_010241642.1| PREDICTED: serine carboxypeptidase-like 51 isoform X1 [Nelumbo nucifera] Length = 461 Score = 110 bits (276), Expect = 3e-22 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -3 Query: 161 QDESEQWGYVEVRPKCHMFWWIYRSPYRVEDPSKPWPIILWLQGGPGASGVG 6 +D SEQWGY++VRPK HMFWW+YRSP+RVEDPSKPWPIILWLQGGPG+SGVG Sbjct: 32 KDGSEQWGYIQVRPKAHMFWWLYRSPHRVEDPSKPWPIILWLQGGPGSSGVG 83