BLASTX nr result
ID: Papaver29_contig00048047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00048047 (644 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17596.3| unnamed protein product [Vitis vinifera] 79 1e-14 emb|CBI36730.3| unnamed protein product [Vitis vinifera] 79 1e-14 ref|XP_010528118.1| PREDICTED: 60S ribosomal protein L38 [Tarena... 76 3e-14 ref|XP_010469305.1| PREDICTED: 60S ribosomal protein L38-like [C... 75 3e-14 ref|XP_003593868.1| 60S ribosomal protein L38A [Medicago truncat... 77 4e-14 ref|XP_012570877.1| PREDICTED: 60S ribosomal protein L38-like, p... 78 6e-14 ref|XP_002514807.1| 60S ribosomal protein L38, putative [Ricinus... 76 1e-13 ref|XP_006595070.1| PREDICTED: 60S ribosomal protein L38 isoform... 76 1e-13 emb|CDY44229.1| BnaC03g24210D [Brassica napus] 74 1e-13 ref|XP_006292105.1| hypothetical protein CARUB_v10018301mg, part... 74 1e-13 ref|XP_013462650.1| 60S ribosomal protein L38A [Medicago truncat... 77 1e-13 tpg|DAA48324.1| TPA: hypothetical protein ZEAMMB73_262778, parti... 76 1e-13 ref|NP_181874.1| 60S ribosomal protein L38 [Arabidopsis thaliana... 74 1e-13 ref|XP_009142937.1| PREDICTED: 60S ribosomal protein L38-like [B... 74 1e-13 ref|XP_009138904.1| PREDICTED: 60S ribosomal protein L38-like [B... 74 1e-13 emb|CDX67802.1| BnaA07g18420D [Brassica napus] 74 1e-13 emb|CDX71899.1| BnaC08g29750D [Brassica napus] 74 1e-13 emb|CDX79823.1| BnaA05g03330D [Brassica napus] 74 1e-13 emb|CDX83482.1| BnaA03g20240D [Brassica napus] 74 1e-13 emb|CDX98380.1| BnaC06g17410D [Brassica napus] 74 1e-13 >emb|CBI17596.3| unnamed protein product [Vitis vinifera] Length = 127 Score = 79.0 bits (193), Expect(2) = 1e-14 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 481 SFRPQSQPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 SFR PKQI+EIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 53 SFRNSKMPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 99 Score = 28.1 bits (61), Expect(2) = 1e-14 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQ 286 EKA+KLKQSLPP ++ Q Sbjct: 109 EKADKLKQSLPPGLSVQ 125 >emb|CBI36730.3| unnamed protein product [Vitis vinifera] Length = 96 Score = 79.0 bits (193), Expect(2) = 1e-14 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 478 FRPQSQPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 F P++ PKQI+EIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 23 FSPKTPPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 68 Score = 28.1 bits (61), Expect(2) = 1e-14 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQ 286 EKA+KLKQSLPP ++ Q Sbjct: 78 EKADKLKQSLPPGLSVQ 94 >ref|XP_010528118.1| PREDICTED: 60S ribosomal protein L38 [Tarenaya hassleriana] Length = 93 Score = 75.9 bits (185), Expect(2) = 3e-14 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQINEIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 26 PKQINEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 65 Score = 30.0 bits (66), Expect(2) = 3e-14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 74 QEKADKLKQSLPPGLSVQ 91 >ref|XP_010469305.1| PREDICTED: 60S ribosomal protein L38-like [Camelina sativa] Length = 81 Score = 75.5 bits (184), Expect(2) = 3e-14 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -2 Query: 463 QPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 QPKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 13 QPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 53 Score = 30.0 bits (66), Expect(2) = 3e-14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 62 QEKADKLKQSLPPGLSVQ 79 >ref|XP_003593868.1| 60S ribosomal protein L38A [Medicago truncatula] gi|355482916|gb|AES64119.1| 60S ribosomal protein L38A [Medicago truncatula] Length = 69 Score = 77.0 bits (188), Expect(2) = 4e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQINEIKDFLLTARRKDARSVRIK+SKDVVKFKVRCS + Sbjct: 2 PKQINEIKDFLLTARRKDARSVRIKRSKDVVKFKVRCSKY 41 Score = 28.1 bits (61), Expect(2) = 4e-14 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQ 286 EKA+KLKQSLPP ++ Q Sbjct: 51 EKADKLKQSLPPGLSVQ 67 >ref|XP_012570877.1| PREDICTED: 60S ribosomal protein L38-like, partial [Cicer arietinum] Length = 71 Score = 77.8 bits (190), Expect(2) = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 463 QPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 QPKQINEIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 3 QPKQINEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 43 Score = 26.9 bits (58), Expect(2) = 6e-14 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQ 286 EKA+KLKQSLPP + Q Sbjct: 53 EKADKLKQSLPPGLNVQ 69 >ref|XP_002514807.1| 60S ribosomal protein L38, putative [Ricinus communis] gi|223545858|gb|EEF47361.1| 60S ribosomal protein L38, putative [Ricinus communis] Length = 78 Score = 75.9 bits (185), Expect(2) = 1e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 463 QPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 QPKQI+EIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 10 QPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 50 Score = 28.1 bits (61), Expect(2) = 1e-13 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQ 286 EKA+KLKQSLPP ++ Q Sbjct: 60 EKADKLKQSLPPGLSVQ 76 >ref|XP_006595070.1| PREDICTED: 60S ribosomal protein L38 isoform X2 [Glycine max] gi|571515197|ref|XP_006597216.1| PREDICTED: 60S ribosomal protein L38-like isoform X1 [Glycine max] Length = 70 Score = 75.9 bits (185), Expect(2) = 1e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 463 QPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 QPKQI+EIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 2 QPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 42 Score = 28.1 bits (61), Expect(2) = 1e-13 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQ 286 EKA+KLKQSLPP ++ Q Sbjct: 52 EKADKLKQSLPPGLSVQ 68 >emb|CDY44229.1| BnaC03g24210D [Brassica napus] Length = 86 Score = 73.9 bits (180), Expect(2) = 1e-13 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 466 SQPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 + PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 17 TMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSKY 58 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 67 QEKADKLKQSLPPGLSVQ 84 >ref|XP_006292105.1| hypothetical protein CARUB_v10018301mg, partial [Capsella rubella] gi|482560812|gb|EOA25003.1| hypothetical protein CARUB_v10018301mg, partial [Capsella rubella] Length = 100 Score = 73.9 bits (180), Expect(2) = 1e-13 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 466 SQPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 + PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 31 TMPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 72 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 81 QEKADKLKQSLPPGLSVQ 98 >ref|XP_013462650.1| 60S ribosomal protein L38A [Medicago truncatula] gi|657396798|gb|KEH36685.1| 60S ribosomal protein L38A [Medicago truncatula] Length = 64 Score = 77.0 bits (188), Expect(2) = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQINEIKDFLLTARRKDARSVRIK+SKDVVKFKVRCS + Sbjct: 2 PKQINEIKDFLLTARRKDARSVRIKRSKDVVKFKVRCSKY 41 Score = 26.6 bits (57), Expect(2) = 1e-13 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -3 Query: 336 EKAEKLKQSLPP 301 EKA+KLKQSLPP Sbjct: 51 EKADKLKQSLPP 62 >tpg|DAA48324.1| TPA: hypothetical protein ZEAMMB73_262778, partial [Zea mays] Length = 84 Score = 75.9 bits (185), Expect(2) = 1e-13 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -2 Query: 463 QPKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 QPKQI+EIKDFLLTARRKDARSV+IK+SKDVVKFKVRCS + Sbjct: 16 QPKQIHEIKDFLLTARRKDARSVKIKRSKDVVKFKVRCSKY 56 Score = 27.7 bits (60), Expect(2) = 1e-13 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 336 EKAEKLKQSLPPDVAEQVI 280 EKA KLKQSLPP ++ Q + Sbjct: 66 EKANKLKQSLPPGLSVQEV 84 >ref|NP_181874.1| 60S ribosomal protein L38 [Arabidopsis thaliana] gi|15231705|ref|NP_191513.1| 60S ribosomal protein L38 [Arabidopsis thaliana] gi|297820788|ref|XP_002878277.1| 60S ribosomal protein L38 [Arabidopsis lyrata subsp. lyrata] gi|297828045|ref|XP_002881905.1| 60S ribosomal protein L38 [Arabidopsis lyrata subsp. lyrata] gi|565475462|ref|XP_006295372.1| hypothetical protein CARUB_v10024464mg [Capsella rubella] gi|567165359|ref|XP_006397512.1| hypothetical protein EUTSA_v10001710mg [Eutrema salsugineum] gi|567183414|ref|XP_006402678.1| hypothetical protein EUTSA_v10006355mg [Eutrema salsugineum] gi|685364922|ref|XP_009116617.1| PREDICTED: 60S ribosomal protein L38 [Brassica rapa] gi|685364931|ref|XP_009116621.1| PREDICTED: 60S ribosomal protein L38 [Brassica rapa] gi|922467044|ref|XP_013633803.1| PREDICTED: 60S ribosomal protein L38 [Brassica oleracea var. oleracea] gi|922512698|ref|XP_013591995.1| PREDICTED: 60S ribosomal protein L38 [Brassica oleracea var. oleracea] gi|922554517|ref|XP_013605304.1| PREDICTED: 60S ribosomal protein L38 isoform X2 [Brassica oleracea var. oleracea] gi|922563865|ref|XP_013610207.1| PREDICTED: 60S ribosomal protein L38 [Brassica oleracea var. oleracea] gi|923604126|ref|XP_013742096.1| PREDICTED: 60S ribosomal protein L38 [Brassica napus] gi|923675480|ref|XP_013651990.1| PREDICTED: 60S ribosomal protein L38 [Brassica napus] gi|923716184|ref|XP_013663868.1| PREDICTED: 60S ribosomal protein L38 [Brassica napus] gi|923840243|ref|XP_013700685.1| PREDICTED: 60S ribosomal protein L38 [Brassica napus] gi|3122724|sp|O22860.1|RL38_ARATH RecName: Full=60S ribosomal protein L38 gi|13605720|gb|AAK32853.1|AF361841_1 AT3g59540/T16L24_90 [Arabidopsis thaliana] gi|2289009|gb|AAB64338.1| 60S ribosomal protein L38 [Arabidopsis thaliana] gi|6996290|emb|CAB75451.1| 60S RIBOSOMAL PROTEIN L38-like protein [Arabidopsis thaliana] gi|21593879|gb|AAM65846.1| 60S RIBOSOMAL PROTEIN L38-like protein [Arabidopsis thaliana] gi|23507773|gb|AAN38690.1| At3g59540/T16L24_90 [Arabidopsis thaliana] gi|90962934|gb|ABE02391.1| At2g43460 [Arabidopsis thaliana] gi|297324115|gb|EFH54536.1| 60S ribosomal protein L38 [Arabidopsis lyrata subsp. lyrata] gi|297327744|gb|EFH58164.1| 60S ribosomal protein L38 [Arabidopsis lyrata subsp. lyrata] gi|330255178|gb|AEC10272.1| 60S ribosomal protein L38 [Arabidopsis thaliana] gi|332646417|gb|AEE79938.1| 60S ribosomal protein L38 [Arabidopsis thaliana] gi|482564080|gb|EOA28270.1| hypothetical protein CARUB_v10024464mg [Capsella rubella] gi|557098585|gb|ESQ38965.1| hypothetical protein EUTSA_v10001710mg [Eutrema salsugineum] gi|557103777|gb|ESQ44131.1| hypothetical protein EUTSA_v10006355mg [Eutrema salsugineum] Length = 69 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 2 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 41 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 50 QEKADKLKQSLPPGLSVQ 67 >ref|XP_009142937.1| PREDICTED: 60S ribosomal protein L38-like [Brassica rapa] gi|923622462|ref|XP_013747897.1| PREDICTED: 60S ribosomal protein L38-like [Brassica napus] Length = 69 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 2 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSKY 41 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 50 QEKADKLKQSLPPGLSVQ 67 >ref|XP_009138904.1| PREDICTED: 60S ribosomal protein L38-like [Brassica rapa] Length = 115 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 48 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 87 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 96 QEKADKLKQSLPPGLSVQ 113 >emb|CDX67802.1| BnaA07g18420D [Brassica napus] Length = 112 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 45 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 84 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 93 QEKADKLKQSLPPGLSVQ 110 >emb|CDX71899.1| BnaC08g29750D [Brassica napus] Length = 102 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 35 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 74 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 83 QEKADKLKQSLPPGLSVQ 100 >emb|CDX79823.1| BnaA05g03330D [Brassica napus] Length = 89 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 22 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSKY 61 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 70 QEKADKLKQSLPPGLSVQ 87 >emb|CDX83482.1| BnaA03g20240D [Brassica napus] Length = 77 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 10 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSKY 49 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 58 QEKADKLKQSLPPGLSVQ 75 >emb|CDX98380.1| BnaC06g17410D [Brassica napus] Length = 104 Score = 73.6 bits (179), Expect(2) = 1e-13 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -2 Query: 460 PKQINEIKDFLLTARRKDARSVRIKKSKDVVKFKVRCSNF 341 PKQI+EIKDFLLTARRKDARSV+IK+SKD+VKFKVRCS + Sbjct: 37 PKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY 76 Score = 30.0 bits (66), Expect(2) = 1e-13 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 339 QEKAEKLKQSLPPDVAEQ 286 QEKA+KLKQSLPP ++ Q Sbjct: 85 QEKADKLKQSLPPGLSVQ 102