BLASTX nr result
ID: Papaver29_contig00047844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047844 (403 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA19129.1| hypothetical protein SOVF_064550 isoform C [Spina... 57 7e-06 gb|KNA19128.1| hypothetical protein SOVF_064550 isoform B [Spina... 57 7e-06 gb|KNA19127.1| hypothetical protein SOVF_064550 isoform A [Spina... 57 7e-06 ref|XP_010673211.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6... 57 7e-06 ref|XP_010673210.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6... 57 7e-06 ref|XP_010646850.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6... 56 9e-06 emb|CAN68806.1| hypothetical protein VITISV_001078 [Vitis vinifera] 56 9e-06 >gb|KNA19129.1| hypothetical protein SOVF_064550 isoform C [Spinacia oleracea] Length = 901 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKD++SI+IDGHFISV NLKE Sbjct: 1 MAVYYKFKSAKDYDSISIDGHFISVANLKE 30 >gb|KNA19128.1| hypothetical protein SOVF_064550 isoform B [Spinacia oleracea] Length = 900 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKD++SI+IDGHFISV NLKE Sbjct: 1 MAVYYKFKSAKDYDSISIDGHFISVANLKE 30 >gb|KNA19127.1| hypothetical protein SOVF_064550 isoform A [Spinacia oleracea] Length = 899 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKD++SI+IDGHFISV NLKE Sbjct: 1 MAVYYKFKSAKDYDSISIDGHFISVANLKE 30 >ref|XP_010673211.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6-like isoform X2 [Beta vulgaris subsp. vulgaris] gi|870863754|gb|KMT14901.1| hypothetical protein BVRB_3g064150 isoform A [Beta vulgaris subsp. vulgaris] Length = 940 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKD++SI+IDGHFISV NLKE Sbjct: 1 MAVYYKFKSAKDYDSISIDGHFISVANLKE 30 >ref|XP_010673210.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6-like isoform X1 [Beta vulgaris subsp. vulgaris] gi|870863755|gb|KMT14902.1| hypothetical protein BVRB_3g064150 isoform B [Beta vulgaris subsp. vulgaris] Length = 941 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKD++SI+IDGHFISV NLKE Sbjct: 1 MAVYYKFKSAKDYDSISIDGHFISVANLKE 30 >ref|XP_010646850.1| PREDICTED: E3 ubiquitin-protein ligase RBBP6 [Vitis vinifera] gi|296083495|emb|CBI23464.3| unnamed protein product [Vitis vinifera] Length = 828 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKDF+SI IDGHFIS+ NLKE Sbjct: 1 MAVYYKFKSAKDFDSIPIDGHFISIGNLKE 30 >emb|CAN68806.1| hypothetical protein VITISV_001078 [Vitis vinifera] Length = 828 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 92 MAVYYKFKSAKDFNSIAIDGHFISVFNLKE 3 MAVYYKFKSAKDF+SI IDGHFIS+ NLKE Sbjct: 1 MAVYYKFKSAKDFDSIPIDGHFISIGNLKE 30