BLASTX nr result
ID: Papaver29_contig00047619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047619 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010261590.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 >ref|XP_010261590.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950 [Nelumbo nucifera] Length = 618 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 3/71 (4%) Frame = +2 Query: 167 DFMTTIVRQVCKVILSQPKWETTPLSNSLTI---VLFDQNCIEDIIEGQVTASLSRRFFN 337 DF I +VCK I +QP+WE T LS+ ++ + NCI +I++ Q A S RFFN Sbjct: 64 DFTEVIAGEVCKTIRTQPRWERTLLSDFPSLGRDIFHHSNCILEILKRQNNAFFSIRFFN 123 Query: 338 WICSQGVFTPD 370 W+CS F+PD Sbjct: 124 WLCSHPDFSPD 134