BLASTX nr result
ID: Papaver29_contig00047476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047476 (623 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010650455.1| PREDICTED: F-box protein CPR30-like isoform ... 65 2e-08 emb|CBI39148.3| unnamed protein product [Vitis vinifera] 65 2e-08 ref|XP_010067990.1| PREDICTED: F-box protein DOR-like [Eucalyptu... 64 7e-08 gb|KCW62667.1| hypothetical protein EUGRSUZ_G00214 [Eucalyptus g... 64 7e-08 gb|KQL30072.1| hypothetical protein SETIT_017332mg [Setaria ital... 62 2e-07 ref|XP_012700658.1| PREDICTED: putative F-box protein At2g02030 ... 62 2e-07 ref|XP_010067995.1| PREDICTED: uncharacterized protein LOC104454... 62 3e-07 gb|KRG99676.1| hypothetical protein GLYMA_18G162700 [Glycine max] 62 3e-07 ref|XP_003621771.2| F-box and associated interaction domain prot... 62 3e-07 ref|XP_006603439.1| PREDICTED: F-box/kelch-repeat protein At3g23... 62 3e-07 ref|XP_004305715.1| PREDICTED: F-box/kelch-repeat protein At3g06... 61 6e-07 ref|XP_013459363.1| F-box protein interaction domain protein [Me... 60 7e-07 ref|XP_013441861.1| F-box protein interaction domain protein [Me... 60 7e-07 gb|KRG99667.1| hypothetical protein GLYMA_18G161800 [Glycine max] 60 1e-06 ref|XP_013448641.1| F-box protein interaction domain protein [Me... 60 1e-06 ref|XP_006603433.1| PREDICTED: F-box/kelch-repeat protein At3g23... 60 1e-06 gb|KRG99747.1| hypothetical protein GLYMA_18G168400 [Glycine max] 60 1e-06 gb|KCW62670.1| hypothetical protein EUGRSUZ_G00229 [Eucalyptus g... 60 1e-06 ref|XP_004306995.1| PREDICTED: F-box/kelch-repeat protein At3g06... 60 1e-06 gb|AFK44336.1| unknown [Lotus japonicus] 60 1e-06 >ref|XP_010650455.1| PREDICTED: F-box protein CPR30-like isoform X1 [Vitis vinifera] Length = 357 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFMVVPTETRK 134 +++M++ILSRL VKSLLRF+CVCK W LI P F++ HL + RP + +VVP Sbjct: 6 EVIMVDILSRLPVKSLLRFRCVCKAWCTLISH-PQFVETHLRQQHKRPVIGLVVPHSVDD 64 Query: 133 PIHR 122 P+H+ Sbjct: 65 PLHK 68 >emb|CBI39148.3| unnamed protein product [Vitis vinifera] Length = 711 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFMVVPTETRK 134 +++M++ILSRL VKSLLRF+CVCK W LI P F++ HL + RP + +VVP Sbjct: 6 EVIMVDILSRLPVKSLLRFRCVCKAWCTLISH-PQFVETHLRQQHKRPVIGLVVPHSVDD 64 Query: 133 PIHR 122 P+H+ Sbjct: 65 PLHK 68 >ref|XP_010067990.1| PREDICTED: F-box protein DOR-like [Eucalyptus grandis] Length = 543 Score = 63.9 bits (154), Expect = 7e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -2 Query: 307 VMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFM 158 +++EIL RL VKSL +F CV RWR+LI DPYFIDLHLT S RP L + Sbjct: 20 LLIEILKRLPVKSLCQFTCVSTRWRFLI-SDPYFIDLHLTHSATRPKLLV 68 >gb|KCW62667.1| hypothetical protein EUGRSUZ_G00214 [Eucalyptus grandis] Length = 379 Score = 63.9 bits (154), Expect = 7e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -2 Query: 307 VMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFM 158 +++EIL RL VKSL +F CV RWR+LI DPYFIDLHLT S RP L + Sbjct: 7 LLIEILKRLPVKSLCQFTCVSTRWRFLI-SDPYFIDLHLTHSATRPKLLV 55 >gb|KQL30072.1| hypothetical protein SETIT_017332mg [Setaria italica] Length = 418 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFMVVPTE 143 DL++ E+L RL K L RFKCVC+ WR +E DP F+ HL S A P +V+P E Sbjct: 21 DLLLSEVLPRLPAKHLARFKCVCRSWRAAVESDPAFVRRHLELSRAAPPCILVIPCE 77 >ref|XP_012700658.1| PREDICTED: putative F-box protein At2g02030 [Setaria italica] Length = 420 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFMVVPTE 143 DL++ E+L RL K L RFKCVC+ WR +E DP F+ HL S A P +V+P E Sbjct: 23 DLLLSEVLPRLPAKHLARFKCVCRSWRAAVESDPAFVRRHLELSRAAPPCILVIPCE 79 >ref|XP_010067995.1| PREDICTED: uncharacterized protein LOC104454805 [Eucalyptus grandis] Length = 627 Score = 62.0 bits (149), Expect = 3e-07 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 307 VMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFM 158 +++EIL RL VKSL +F CV RWR LI DPYFIDLHLT S RP L + Sbjct: 7 LLIEILKRLPVKSLCQFTCVSTRWRSLI-SDPYFIDLHLTHSATRPKLLV 55 >gb|KRG99676.1| hypothetical protein GLYMA_18G162700 [Glycine max] Length = 333 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNL 164 D + EILSRL VK L++FKCVCK W LI DPYFI LHL++S A+ NL Sbjct: 14 DELFEEILSRLPVKPLMQFKCVCKGWNSLI-SDPYFIKLHLSKSAAKDNL 62 >ref|XP_003621771.2| F-box and associated interaction domain protein [Medicago truncatula] gi|657376907|gb|AES77989.2| F-box and associated interaction domain protein [Medicago truncatula] Length = 352 Score = 61.6 bits (148), Expect = 3e-07 Identities = 34/58 (58%), Positives = 39/58 (67%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFMVVPTET 140 D VM EILSRL V+SL++ KCVCK W +I DP FI +HL RS PN F VV ET Sbjct: 25 DEVMAEILSRLPVRSLMQIKCVCKSWNTII-SDPKFIKMHLNRSARNPN-FSVVSYET 80 >ref|XP_006603439.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Glycine max] Length = 199 Score = 61.6 bits (148), Expect = 3e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNL 164 D + EILSRL VK L++FKCVCK W LI DPYFI LHL++S A+ NL Sbjct: 14 DELFEEILSRLPVKPLMQFKCVCKGWNSLI-SDPYFIKLHLSKSAAKDNL 62 >ref|XP_004305715.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Fragaria vesca subsp. vesca] Length = 393 Score = 60.8 bits (146), Expect = 6e-07 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = -2 Query: 355 VVSNTISGVDGDSVDL--VMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLT 188 V S T +S+DL V++EILSRL KSLLRF+CVCK WR LI DPYFI HL+ Sbjct: 14 VPSGTALRFSSESIDLDPVIVEILSRLPAKSLLRFRCVCKAWRALI-SDPYFIRKHLS 70 >ref|XP_013459363.1| F-box protein interaction domain protein [Medicago truncatula] gi|657392443|gb|KEH33394.1| F-box protein interaction domain protein [Medicago truncatula] Length = 466 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -2 Query: 316 VDLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFM 158 +D +++EILSRL VK+L++FKCVCK W+ LI DP F LHL RS +L + Sbjct: 24 LDELIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLRRSPRNTHLLL 76 >ref|XP_013441861.1| F-box protein interaction domain protein [Medicago truncatula] gi|657369443|gb|KEH15886.1| F-box protein interaction domain protein [Medicago truncatula] Length = 430 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -2 Query: 316 VDLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFM 158 +D +++EILSRL VK+L++FKCVCK W+ LI DP F LHL RS +L + Sbjct: 24 LDELIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSPRNTHLLL 76 >gb|KRG99667.1| hypothetical protein GLYMA_18G161800 [Glycine max] Length = 385 Score = 60.1 bits (144), Expect = 1e-06 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNL 164 D ++ EILSRL VK L++FKCVCK W L+ DPYFI+LHL++S A+ +L Sbjct: 14 DELIEEILSRLPVKPLIQFKCVCKGWNSLM-SDPYFIELHLSKSAAKDDL 62 >ref|XP_013448641.1| F-box protein interaction domain protein [Medicago truncatula] gi|657377824|gb|KEH22668.1| F-box protein interaction domain protein [Medicago truncatula] Length = 418 Score = 60.1 bits (144), Expect = 1e-06 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 316 VDLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFMV 155 +D ++++ILSRL VK+L++FKCVCK W+ LI DP F LHL RS +L +V Sbjct: 19 LDELIVDILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRSPRNTHLTLV 72 >ref|XP_006603433.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Glycine max] Length = 432 Score = 60.1 bits (144), Expect = 1e-06 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNL 164 D ++ EILSRL VK L++FKCVCK W L+ DPYFI+LHL++S A+ +L Sbjct: 25 DELIEEILSRLPVKPLIQFKCVCKGWNSLM-SDPYFIELHLSKSAAKDDL 73 >gb|KRG99747.1| hypothetical protein GLYMA_18G168400 [Glycine max] Length = 334 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 307 VMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNL 164 ++ EILSRL VK L++FKCVCK W LI +PYFI LHL++S A+ +L Sbjct: 20 IIKEILSRLPVKPLIKFKCVCKEWNSLI-SEPYFIKLHLSKSAAKDDL 66 >gb|KCW62670.1| hypothetical protein EUGRSUZ_G00229 [Eucalyptus grandis] Length = 378 Score = 59.7 bits (143), Expect = 1e-06 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -2 Query: 307 VMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLTRSIARPNLFM 158 +++EIL RL VKSL +F CV RW LI DPYFIDLHLT S RP L + Sbjct: 7 LLIEILKRLPVKSLCQFTCVSTRWSSLI-SDPYFIDLHLTHSATRPKLLV 55 >ref|XP_004306995.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Fragaria vesca subsp. vesca] gi|764627324|ref|XP_011469232.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Fragaria vesca subsp. vesca] Length = 377 Score = 59.7 bits (143), Expect = 1e-06 Identities = 32/76 (42%), Positives = 47/76 (61%) Frame = -2 Query: 367 NANPVVSNTISGVDGDSVDLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFIDLHLT 188 N PV+S ++ D + +++ILSRL VK+L+RF+CVCK WR LI D + + HL Sbjct: 9 NKQPVISGGRPHIESDDL---LIDILSRLPVKTLVRFRCVCKSWRALI-SDSHLVTTHLR 64 Query: 187 RSIARPNLFMVVPTET 140 RS R LF + P ++ Sbjct: 65 RSNRRRLLFSLAPYQS 80 >gb|AFK44336.1| unknown [Lotus japonicus] Length = 193 Score = 59.7 bits (143), Expect = 1e-06 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%) Frame = -2 Query: 313 DLVMMEILSRLRVKSLLRFKCVCKRWRYLIEQDPYFI--DLHLTRSIARPNLFMVVPTET 140 D +++EILSRL VKSLL+F+CVCK W LI DPYFI LHL++ N ++ + T Sbjct: 65 DELVVEILSRLPVKSLLKFRCVCKSWMLLI-SDPYFIKKHLHLSKQSTLFNHHRIILSAT 123 Query: 139 RKPIHRGGTSCKDVFLAANLISE 71 H S +F + + + E Sbjct: 124 TAEFHLKSCSVSSLFNSTSTVCE 146