BLASTX nr result
ID: Papaver29_contig00047442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047442 (844 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO52565.1| hypothetical protein CISIN_1g046579mg [Citrus sin... 60 3e-06 ref|XP_006421543.1| hypothetical protein CICLE_v10005096mg [Citr... 60 3e-06 ref|XP_006382693.1| hypothetical protein POPTR_0005s04500g [Popu... 59 3e-06 gb|KDP27588.1| hypothetical protein JCGZ_19593 [Jatropha curcas] 59 6e-06 >gb|KDO52565.1| hypothetical protein CISIN_1g046579mg [Citrus sinensis] Length = 416 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 730 NNIDLITEILLCLPIKSLLVFKSVSKQWLCLITDPSFA 843 NN DL+TEILLCLPIKSLL FK+VSK WL LI++P F+ Sbjct: 34 NNDDLLTEILLCLPIKSLLKFKAVSKHWLSLISNPIFS 71 >ref|XP_006421543.1| hypothetical protein CICLE_v10005096mg [Citrus clementina] gi|557523416|gb|ESR34783.1| hypothetical protein CICLE_v10005096mg [Citrus clementina] Length = 403 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 730 NNIDLITEILLCLPIKSLLVFKSVSKQWLCLITDPSFA 843 NN DL+TEILLCLPIKSLL FK+VSK WL LI++P F+ Sbjct: 34 NNDDLLTEILLCLPIKSLLKFKAVSKHWLSLISNPIFS 71 >ref|XP_006382693.1| hypothetical protein POPTR_0005s04500g [Populus trichocarpa] gi|550338058|gb|ERP60490.1| hypothetical protein POPTR_0005s04500g [Populus trichocarpa] Length = 449 Score = 59.3 bits (142), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 724 VGNNIDLITEILLCLPIKSLLVFKSVSKQWLCLITDPSF 840 +GNN+DL+TEILL +P K LL FK VSKQWL LI+DP F Sbjct: 89 IGNNLDLVTEILLRVPAKPLLKFKCVSKQWLSLISDPKF 127 >gb|KDP27588.1| hypothetical protein JCGZ_19593 [Jatropha curcas] Length = 398 Score = 58.5 bits (140), Expect = 6e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 724 VGNNIDLITEILLCLPIKSLLVFKSVSKQWLCLITDPSFA 843 + NN DL+ +ILLCLPIKSL FKSVSK WL LIT+P F+ Sbjct: 19 IANNDDLLIQILLCLPIKSLFKFKSVSKHWLSLITNPLFS 58