BLASTX nr result
ID: Papaver29_contig00047035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00047035 (759 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79464.1| hypothetical protein VITISV_006867 [Vitis vinifera] 50 5e-06 >emb|CAN79464.1| hypothetical protein VITISV_006867 [Vitis vinifera] Length = 826 Score = 49.7 bits (117), Expect(2) = 5e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +2 Query: 230 PGKNHVGMAEVEAAIQEMFQAPHIQVI 310 PGK VGMAEVEAAIQEMFQAPHIQV+ Sbjct: 700 PGKALVGMAEVEAAIQEMFQAPHIQVM 726 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 16 QAAEIADYKIKRSSSTLNFSSAGIYKVLYKFP 111 +AAE+ADY IK+ +S + SS G++ V +P Sbjct: 650 RAAELADYHIKKLASPPDSSSEGLHFVEKYYP 681