BLASTX nr result
ID: Papaver29_contig00044626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00044626 (720 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281627.1| PREDICTED: probable ascorbate-specific trans... 62 4e-07 emb|CBI26790.3| unnamed protein product [Vitis vinifera] 59 4e-06 ref|XP_002281620.1| PREDICTED: probable ascorbate-specific trans... 59 4e-06 >ref|XP_002281627.1| PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Vitis vinifera] gi|297737588|emb|CBI26789.3| unnamed protein product [Vitis vinifera] Length = 222 Score = 62.0 bits (149), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 105 WLFAFFSFWWYPGAGMPTRERLVPWHAFVGMVIFL 1 W+FAFFSFW +PGA MPTR RL+PWH F GMVIFL Sbjct: 137 WVFAFFSFW-FPGAEMPTRGRLMPWHWFAGMVIFL 170 >emb|CBI26790.3| unnamed protein product [Vitis vinifera] Length = 190 Score = 58.5 bits (140), Expect = 4e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 105 WLFAFFSFWWYPGAGMPTRERLVPWHAFVGMVIFL 1 W+FAFFSFW YPG P R RL+PWH F GMVIFL Sbjct: 79 WMFAFFSFW-YPGVKKPRRRRLMPWHWFAGMVIFL 112 >ref|XP_002281620.1| PREDICTED: probable ascorbate-specific transmembrane electron transporter 1 [Vitis vinifera] Length = 248 Score = 58.5 bits (140), Expect = 4e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -1 Query: 105 WLFAFFSFWWYPGAGMPTRERLVPWHAFVGMVIFL 1 W+FAFFSFW YPG P R RL+PWH F GMVIFL Sbjct: 137 WMFAFFSFW-YPGVKKPRRRRLMPWHWFAGMVIFL 170