BLASTX nr result
ID: Papaver29_contig00043992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043992 (1013 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244022.1| PREDICTED: uncharacterized protein LOC101244... 40 7e-06 ref|XP_006346107.1| PREDICTED: uncharacterized protein LOC102602... 39 7e-06 >ref|XP_004244022.1| PREDICTED: uncharacterized protein LOC101244505 [Solanum lycopersicum] Length = 310 Score = 39.7 bits (91), Expect(2) = 7e-06 Identities = 18/38 (47%), Positives = 30/38 (78%) Frame = -1 Query: 617 NAYRMSKSSVNHLFVQSSK**LRNEDVPLEKRKARMIK 504 + + +SK S++ L+VQ+SK L+ +D+P EKRKAR+I+ Sbjct: 248 SGHAISKPSLDQLYVQASKQWLKGQDMPREKRKARIIR 285 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 505 RWLQYHGFGWGVIKFILCKMESKMGQ 428 RWLQY GF W V+ FIL K+ES Q Sbjct: 285 RWLQYRGFDWSVVSFILKKLESSHPQ 310 >ref|XP_006346107.1| PREDICTED: uncharacterized protein LOC102602812 [Solanum tuberosum] Length = 309 Score = 39.3 bits (90), Expect(2) = 7e-06 Identities = 19/38 (50%), Positives = 29/38 (76%) Frame = -1 Query: 617 NAYRMSKSSVNHLFVQSSK**LRNEDVPLEKRKARMIK 504 + + +SK S++ LFVQ+SK L+ + VP EKRKAR+I+ Sbjct: 247 SGHAISKPSLDQLFVQASKQWLKGQGVPREKRKARIIR 284 Score = 39.3 bits (90), Expect(2) = 7e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -2 Query: 505 RWLQYHGFGWGVIKFILCKMESKMGQ 428 RWLQY GF W V+ FIL K+ES Q Sbjct: 284 RWLQYRGFDWSVVSFILKKLESSYPQ 309